KEGG   Homo sapiens (human): 4216Help
Entry
4216              CDS       T01001                                 

Gene name
MAP3K4, MAPKKK4, MEKK_4, MEKK4, MTK1, PRO0412
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 4
  KO
K04428  mitogen-activated protein kinase kinase kinase 4 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04912  GnRH signaling pathway
Module
hsa_M00688  MAPK (JNK) signaling
hsa_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4216 (MAP3K4)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    4216 (MAP3K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4216 (MAP3K4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     4216 (MAP3K4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE11 family
   4216 (MAP3K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like RIO1 DUF3958
Motif
Other DBs
NCBI-GeneID: 4216
NCBI-ProteinID: NP_005913
OMIM: 602425
HGNC: 6856
Ensembl: ENSG00000085511
Vega: OTTHUMG00000015968
Pharos: Q9Y6R4(Tbio)
UniProt: Q9Y6R4 Q9P1M2
Position
6q26
AA seq 1608 aa AA seqDB search
MREAAAALVPPPAFAVTPAAAMEEPPPPPPPPPPPPEPETESEPECCLAARQEGTLGDSA
CKSPESDLEDFSDETNTENLYGTSPPSTPRQMKRMSTKHQRNNVGRPASRSNLKEKMNAP
NQPPHKDTGKTVENVEEYSYKQEKKIRAALRTTERDHKKNVQCSFMLDSVGGSLPKKSIP
DVDLNKPYLSLGCSNAKLPVSVPMPIARPARQTSRTDCPADRLKFFETLRLLLKLTSVSK
KKDREQRGQENTSGFWLNRSNELIWLELQAWHAGRTINDQDFFLYTARQAIPDIINEILT
FKVDYGSFAFVRDRAGFNGTSVEGQCKATPGTKIVGYSTHHEHLQRQRVSFEQVKRIMEL
LEYIEALYPSLQALQKDYEKYAAKDFQDRVQALCLWLNITKDLNQKLRIMGTVLGIKNLS
DIGWPVFEIPSPRPSKGNEPEYEGDDTEGELKELESSTDESEEEQISDPRVPEIRQPIDN
SFDIQSRDCISKKLERLESEDDSLGWGAPDWSTEAGFSRHCLTSIYRPFVDKALKQMGLR
KLILRLHKLMDGSLQRARIALVKNDRPVEFSEFPDPMWGSDYVQLSRTPPSSEEKCSAVS
WEELKAMDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQLVRECKEVLK
GGLLMKQYYQFMLQEVLEDLEKPDCNIDAFEEDLHKMLMVYFDYMRSWIQMLQQLPQASH
SLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLEFGLQESCAEFWTS
ADDSSASDEIRRSVIEISRALKELFHEARERASKALGFAKMLRKDLEIAAEFRLSAPVRD
LLDVLKSKQYVKVQIPGLENLQMFVPDTLAEEKSIILQLLNAAAGKDCSKDSDDVLIDAY
LLLTKHGDRARDSEDSWGTWEAQPVKVVPQVETVDTLRSMQVDNLLLVVMQSAHLTIQRK
AFQQSIEGLMTLCQEQTSSQPVIAKALQQLKNDALELCNRISNAIDRVDHMFTSEFDAEV
DESESVTLQQYYREAMIQGYNFGFEYHKEVVRLMSGEFRQKIGDKYISFARKWMNYVLTK
CESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQALMNECIGHVIGKPHSPVTGL
YLAIHRNSPRPMKVPRCHSDPPNPHLIIPTPEGFSTRSMPSDARSHGSPAAAAAAAAAAV
AASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEP
AYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKSVRLFEEKRYREMRRKNIIGQ
VCDTPKSYDNVMHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKEIRFQPND
HKTIKETADELKIFEGIKHPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLGLQEHVI
RLYSKQITIAINVLHEHGIVHRDIKGANIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVN
STLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTGKRPWHEYEHNFQIMYKVGM
GHKPPIPERLSPEGKDFLSHCLESDPKMRWTASQLLDHSFVKVCTDEE
NT seq 4827 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagccgctgccgcgctggtccctcctcccgcctttgccgtcacgcctgccgcc
gccatggaggagccgccgccaccgccgccgccgccaccaccgccaccggaacccgagacc
gagtcagaacccgagtgctgcttggcggcgaggcaagagggcacattgggagattcagct
tgcaagagtcctgaatctgatctagaagacttctccgatgaaacaaatacagagaatctt
tatggtacctctccccccagcacacctcgacagatgaaacgcatgtcaaccaaacatcag
aggaataatgtggggaggccagccagtcggtctaatttgaaagaaaaaatgaatgcacca
aatcagcctccacataaagacactggaaaaacagtggagaatgtggaagaatacagctat
aagcaggagaaaaagatccgagcagctcttagaacaacagagcgtgatcataaaaaaaat
gtacagtgctcattcatgttagactcagtgggtggatctttgccaaaaaaatcaattcca
gatgtggatctcaataagccttacctcagccttggctgtagcaatgctaagcttccagta
tctgtgcccatgcctatagccagacctgcacgccagacttctaggactgactgtccagca
gatcgtttaaagttttttgaaactttacgacttttgctaaagcttacctcagtctcaaag
aaaaaagacagggagcaaagaggacaagaaaatacgtctggtttctggcttaaccgatct
aacgaactgatctggttagagctacaagcctggcatgcaggacggacaattaacgaccag
gacttctttttatatacagcccgtcaagccatcccagatattattaatgaaatccttact
ttcaaagtcgactatgggagcttcgcctttgttagagatagagctggttttaatggtact
tcagtagaagggcagtgcaaagccactcctggaacaaagattgtaggttactcaacacat
catgagcatctccaacgccagagggtctcatttgagcaggtaaaacggataatggagctg
ctagagtacatagaagcactttatccatcattgcaggctcttcagaaggactatgaaaaa
tatgctgcaaaagacttccaggacagggtgcaggcactctgtttgtggttaaacatcaca
aaagacttaaatcagaaattaaggattatgggcactgttttgggcatcaagaatttatca
gacattggctggccagtgtttgaaatcccttcccctcgaccatccaaaggtaatgagccg
gagtatgagggtgatgacacagaaggagaattaaaggagttggaaagtagtacggatgag
agtgaagaagaacaaatctctgatcctagggtaccggaaatcagacagcccatagataac
agcttcgacatccagtcgcgggactgcatatccaagaagcttgagaggctcgaatctgag
gatgattctcttggctggggagcaccagactggagcacagaagcaggctttagtagacat
tgtctgacttctatttatagaccatttgtagacaaagcactgaagcagatggggttaaga
aagttaattttaagacttcacaagctaatggatggttccttgcaaagggcacgtatagca
ttggtaaagaacgatcgtccagtggagttttctgaatttccagatcccatgtggggttca
gattatgtgcagttgtcaaggacaccaccttcatctgaggagaaatgcagtgctgtgtcg
tgggaggagctgaaggccatggatttaccttcattcgaacctgccttcctagttctctgc
cgagtccttctgaatgtcatacatgagtgtctgaagttaagattggagcagagacctgct
ggagaaccatctctcttgagtattaagcagctggtgagagagtgtaaggaggtcctgaag
ggcggcctgctgatgaagcagtactaccagttcatgctgcaggaggttctggaggacttg
gagaagcccgactgcaacattgacgcttttgaagaggatctacataaaatgcttatggtg
tattttgattacatgagaagctggatccaaatgctacagcaattacctcaagcatcgcat
agtttaaaaaatctgttagaagaagaatggaatttcaccaaagaaataactcattacata
cggggaggagaagcacaggccgggaagcttttctgtgacattgcaggaatgctgctgaaa
tctacaggaagttttttagaatttggcttacaggagagctgtgctgaattttggactagt
gcggatgacagcagtgcttccgacgaaatcaggaggtctgttatagagatcagtcgagcc
ctgaaggagctcttccatgaagccagagaaagggcttccaaagcacttggatttgctaaa
atgttgagaaaggacctggaaatagcagcagaattcaggctttcagccccagttagagac
ctcctggatgttctgaaatcaaaacagtatgtcaaggtgcaaattcctgggttagaaaac
ttgcaaatgtttgttccagacactcttgctgaggagaagagtattattttgcagttactc
aatgcagctgcaggaaaggactgttcaaaagattcagatgacgtactcatcgatgcctat
ctgcttctgaccaagcacggtgatcgagcccgtgattcagaggacagctggggcacctgg
gaggcacagcctgtcaaagtcgtgcctcaggtggagactgttgacaccctgagaagcatg
caggtggataatcttttactagttgtcatgcagtctgcgcatctcacaattcagagaaaa
gctttccagcagtccattgagggacttatgactctgtgccaggagcagacatccagtcag
ccggtcatcgccaaagctttgcagcagctgaagaatgatgcattggagctatgcaacagg
ataagcaatgccattgaccgcgtggaccacatgttcacatcagaatttgatgctgaggtt
gatgaatctgaatctgtcaccttgcaacagtactaccgagaagcaatgattcaggggtac
aattttggatttgagtatcataaagaagttgttcgtttgatgtctggggagtttagacag
aagataggagacaaatatataagctttgcccggaagtggatgaattatgtcctgactaaa
tgtgagagtggtagaggtacaagacccaggtgggcgactcaaggatttgattttctacaa
gcaattgaacctgcctttatttcagctttaccagaagatgacttcttgagtttacaagcc
ttgatgaatgaatgcattggccatgtcataggaaaaccacacagtcctgttacaggtttg
taccttgccattcatcggaacagcccccgtcctatgaaggtacctcgatgccatagtgac
cctcctaacccacacctcattatccccactccagagggattcagcactcggagcatgcct
tccgacgcgcggagccatggcagccctgctgctgctgctgctgctgctgctgctgctgtt
gctgccagtcggcccagcccctctggtggtgactctgtgctgcccaaatccatcagcagt
gcccatgataccaggggttccagcgttcctgaaaatgatcgattggcttccatagctgct
gaattgcagtttaggtccctgagtcgtcactcaagccccacggaggagcgagatgaacca
gcatatccaagaggagattcaagtgggtccacaagaagaagttgggaacttcggacacta
atcagccagagtaaagatactgcttctaaactaggacccatagaagctatccagaagtca
gtccgattgtttgaagaaaagaggtaccgagaaatgaggagaaagaatatcattggtcaa
gtttgtgatacgcctaagtcctatgataatgttatgcacgttggcttgaggaaggtgacc
ttcaaatggcaaagaggaaacaaaattggagaaggccagtatgggaaggtgtacacctgc
atcagcgtcgacaccggggagctgatggccatgaaagagattcgatttcaacctaatgac
cataagactatcaaggaaactgcagacgaattgaaaatattcgaaggcatcaaacacccc
aatctggttcggtattttggtgtggagctccatagagaagaaatgtacatcttcatggag
tactgcgatgaggggactttagaagaggtgtcaaggctgggacttcaggaacatgtgatt
aggctgtattcaaagcagatcaccattgcgatcaacgtcctccatgagcatggcatagtc
caccgtgacattaaaggtgccaatatcttccttacctcatctggattaatcaaactggga
gattttggatgttcagtaaagctcaaaaacaatgcccagaccatgcctggtgaagtgaac
agcaccctggggacagcagcatacatggcacctgaagtcatcactcgtgccaaaggagag
ggccatgggcgtgcggccgacatctggagtctggggtgtgttgtcatagagatggtgact
ggcaagaggccttggcatgagtatgagcacaactttcaaattatgtataaagtggggatg
ggacataagccaccaatccctgaaagattaagccctgaaggaaaggacttcctttctcac
tgccttgagagtgacccaaagatgagatggaccgccagccagctcctcgaccattcgttt
gtcaaggtttgcacagatgaagaatga

DBGET integrated database retrieval system