KEGG   Homo sapiens (human): 4217Help
Entry
4217              CDS       T01001                                 

Gene name
MAP3K5, ASK1, MAPKKK5, MEKK5
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 5
  KO
K04426  mitogen-activated protein kinase kinase kinase 5 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04010  MAPK signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04530  Tight junction
hsa04668  TNF signaling pathway
hsa04714  Thermogenesis
hsa04722  Neurotrophin signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00688  MAPK (JNK) signaling
hsa_M00689  MAPK (p38) signaling
Drug target
Selonsertib: D10988
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4217 (MAP3K5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4217 (MAP3K5)
   04668 TNF signaling pathway
    4217 (MAP3K5)
   04071 Sphingolipid signaling pathway
    4217 (MAP3K5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    4217 (MAP3K5)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    4217 (MAP3K5)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    4217 (MAP3K5)
  09159 Environmental adaptation
   04714 Thermogenesis
    4217 (MAP3K5)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    4217 (MAP3K5)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    4217 (MAP3K5)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4217 (MAP3K5)
  09168 Drug resistance
   01524 Platinum drug resistance
    4217 (MAP3K5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4217 (MAP3K5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     4217 (MAP3K5)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE11 family
   4217 (MAP3K5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4071 Pkinase Pkinase_Tyr FPP Kinase-like
Motif
Other DBs
NCBI-GeneID: 4217
NCBI-ProteinID: NP_005914
OMIM: 602448
HGNC: 6857
Ensembl: ENSG00000197442
Vega: OTTHUMG00000015647
Pharos: Q99683(Tchem)
UniProt: Q99683
Structure
PDB: 

Position
6q23.3
AA seq 1374 aa AA seqDB search
MSTEADEGITFSVPPFAPSGFCTIPEGGICRRGGAAAVGEGEEHQLPPPPPGSFWNVESA
AAPGIGCPAATSSSSATRGRGSSVGGGSRRTTVAYVINEASQGQLVVAESEALQSLREAC
ETVGATLETLHFGKLDFGETTVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANN
IILYCDTNSDSLQSLKEIICQKNTMCTGNYTFVPYMITPHNKVYCCDSSFMKGLTELMQP
NFELLLGPICLPLVDRFIQLLKVAQASSSQYFRESILNDIRKARNLYTGKELAAELARIR
QRVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFDLASHHHVKFHYAFALN
RRNLPGDRAKALDIMIPMVQSEGQVASDMYCLVGRIYKDMFLDSNFTDTESRDHGASWFK
KAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQSYWEVGF
FLGASVLANDHMRVIQASEKLFKLKTPAWYLKSIVETILIYKHFVKLTTEQPVAKQELVD
FWMDFLVEATKTDVTVVRFPVLILEPTKIYQPSYLSINNEVEEKTISIWHVLPDDKKGIH
EWNFSASSVRGVSISKFEERCCFLYVLHNSDDFQIYFCTELHCKKFFEMVNTITEEKGRS
TEEGDCESDLLEYDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQ
PLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTI
GFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFT
GTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVH
PEIPESMSAEAKAFILKCFEPDPDKRACANDLLVDEFLKVSSKKKKTQPKLSALSAGSNE
YLRSISLPVPVLVEDTSSSSEYGSVSPDTELKVDPFSFKTRAKSCGERDVKGIRTLFLGI
PDENFEDHSAPPSPEEKDSGFFMLRKDSERRATLHRILTEDQDKIVRNLMESLAQGAEEP
KLKWEHITTLIASLREFVRSTDRKIIATTLSKLKLELDFDSHGISQVQVVLFGFQDAVNK
VLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADQEDLDVEDDHEE
QPSNQTVRRPQAVIEDAVATSGVSTLSSTVSHDSQSAHRSLNVQLGRMKIETNRLLEELV
RKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVN
GADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT
NT seq 4125 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggaggcggacgagggcatcactttctctgtgccacccttcgccccctcgggc
ttctgcaccatccccgagggcggcatctgcaggaggggaggagcggcggcggtgggcgag
ggcgaggagcaccagctgccaccgccgccgccgggcagcttctggaacgtggagagcgcc
gctgcccctggcatcggttgtccggcggccacctcctcgagcagtgccacccgaggccgg
ggcagctctgttggcgggggcagccgacggaccacggtggcatatgtgatcaacgaagcg
agccaagggcaactggtggtggccgagagcgaggccctgcagagcttgcgggaggcgtgc
gagacagtgggcgccaccctggaaaccctgcattttgggaaactcgactttggagaaacc
accgtgctggaccgcttttacaatgcagatattgcggtggtggagatgagcgatgccttc
cggcagccgtccttgttttaccaccttggggtgagagaaagtttcagcatggccaacaac
atcatcctctactgtgatactaactcggactctctgcagtcactgaaggaaataatttgc
cagaagaatactatgtgcactgggaactacacctttgttccttacatgataactccacat
aacaaagtctactgctgtgacagcagcttcatgaaggggttgacagagctcatgcaaccg
aacttcgagctgcttcttggacccatctgcttacctcttgtggatcgttttattcaactt
ttgaaggtggcacaagcaagttctagccagtacttccgggaatctatactcaatgacatc
aggaaagctcgtaatttatacactggtaaagaattggcagctgagttggcaagaattcgg
cagcgagtagataatatcgaagtcttgacagcagatattgtcataaatctgttactttcc
tacagagatatccaggactatgattctattgtgaagctggtagagactttagaaaaactg
ccaacctttgatttggcctcccatcaccatgtgaagtttcattatgcatttgcactgaat
aggagaaatctccctggtgacagagcaaaagctcttgatattatgattcccatggtgcaa
agcgaaggacaagttgcttcagatatgtattgcctagttggtcgaatctacaaagatatg
tttttggactctaatttcacggacactgaaagcagagaccatggagcttcttggttcaaa
aaggcatttgaatctgagccaacactacagtcaggaattaattatgcggtcctcctcctg
gcagctggacaccagtttgaatcttcctttgagctccggaaagttggggtgaagctaagt
agtcttcttggtaaaaagggaaacttggaaaaactccagagctactgggaagttggattt
tttctgggggccagcgtcctagccaatgaccacatgagagtcattcaagcatctgaaaag
ctttttaaactgaagacaccagcatggtacctcaagtctattgtagagacaattttaata
tataagcattttgtgaaactgaccacagaacagcctgtggccaagcaagaacttgtggac
ttttggatggatttcctggtcgaggccacaaagacagatgttactgtggttaggtttcca
gtattaatattagaaccaaccaaaatctatcaaccttcttatttgtctatcaacaatgaa
gttgaggaaaagacaatctctatttggcacgtgcttcctgatgacaagaaaggtatacat
gagtggaattttagtgcctcttctgtcaggggagtgagtatttctaaatttgaagaaaga
tgctgctttctttatgtgcttcacaattctgatgatttccaaatctatttctgtacagaa
cttcattgtaaaaagttttttgagatggtgaacaccattaccgaagagaaggggagaagc
acagaggaaggagactgtgaaagtgacttgctggagtatgactatgaatatgatgaaaat
ggtgacagagtcgttttaggaaaaggcacttatgggatagtctacgcaggtcgggacttg
agcaaccaagtcagaattgctattaaggaaatcccagagagagacagcagatactctcag
cccctgcatgaagaaatagcattgcataaacacctgaagcacaaaaatattgtccagtat
ctgggctctttcagtgagaatggtttcattaaaatcttcatggagcaggtccctggagga
agtctttctgctctccttcgttccaaatggggtccattaaaagacaatgagcaaacaatt
ggcttttatacaaagcaaatactggaaggattaaaatatctccatgacaatcagatagtt
caccgggacataaagggtgacaatgtgttgattaatacctacagtggtgttctcaagatc
tctgacttcggaacatcaaagaggcttgctggcataaacccctgtactgaaacttttact
ggtaccctccagtatatggcaccagaaataatagataaaggaccaagaggctacggaaaa
gcagcagacatctggtctctgggctgtacaatcattgaaatggccacaggaaaaccccca
ttttatgaactgggagaaccacaagcagctatgttcaaggtgggaatgtttaaagtccac
cctgagatcccagagtccatgtctgcagaggccaaggcattcatactgaaatgttttgaa
ccagatcctgacaagagagcctgtgctaacgacttgcttgttgatgagtttttaaaagtt
tcaagcaaaaagaaaaagacacaacctaagctttcagctctttcagctggatcaaatgaa
tatctcaggagtatatccttgccggtacctgtgctggtggaggacaccagcagcagcagt
gagtacggctcagtttcacccgacacggagttgaaagtggaccccttctctttcaaaaca
agagccaagtcctgcggagaaagagatgtcaagggaattcggacactctttttgggcatt
ccagatgagaattttgaagatcacagtgctcctccttcccctgaagaaaaagattctgga
ttcttcatgctgaggaaggacagtgagaggcgagctacccttcacaggatcctgacggaa
gaccaagacaaaattgtgagaaacctaatggaatctttagctcagggggctgaagaaccg
aaactaaaatgggaacacatcacaaccctcattgcaagcctcagagaatttgtgagatcc
actgaccgaaaaatcatagccaccacactgtcaaagctgaaactggagctggacttcgac
agccatggcattagccaagtccaggtggtactctttggttttcaagatgctgtcaataaa
gttcttcggaatcataacatcaagccgcactggatgtttgccttagacagtatcattcgg
aaggcggtacagacagccattaccatcctggttccagaactaaggccacatttcagcctt
gcatctgagagtgatactgctgatcaagaagacttggatgtagaagatgaccatgaggaa
cagccttcaaatcaaactgtccgaagacctcaggctgtcattgaagatgctgtggctacc
tcaggcgtgagcacgctcagttctactgtgtctcatgattcccagagtgctcaccggtca
ctgaatgtacagcttggaaggatgaaaatagaaaccaatagattactggaagaattggtt
cggaaagagaaagaattacaagcactccttcatcgagctattgaagaaaaagaccaagaa
attaaacacctgaagcttaagtcccaacccatagaaattcctgaattgcctgtatttcat
ctaaattcttctggcacaaatactgaagattctgaacttaccgactggctgagagtgaat
ggagctgatgaagacactataagccggtttttggctgaagattatacactattggatgtt
ctctactatgttacacgtgatgacttaaaatgcttgagactaaggggagggatgctgtgc
acactgtggaaggctatcattgactttcgaaacaaacagacttga

DBGET integrated database retrieval system