KEGG   Homo sapiens (human): 4218
Entry
4218              CDS       T01001                                 

Gene name
RAB8A, MEL, RAB8
Definition
(RefSeq) RAB8A, member RAS oncogene family
  KO
K07901  Ras-related protein Rab-8A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04144  Endocytosis
hsa04152  AMPK signaling pathway
hsa04530  Tight junction
hsa04972  Pancreatic secretion
hsa05014  Amyotrophic lateral sclerosis
hsa05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    4218 (RAB8A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4218 (RAB8A)
   04140 Autophagy - animal
    4218 (RAB8A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    4218 (RAB8A)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    4218 (RAB8A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    4218 (RAB8A)
   05022 Pathways of neurodegeneration - multiple diseases
    4218 (RAB8A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4218 (RAB8A)
   03036 Chromosome and associated proteins [BR:hsa03036]
    4218 (RAB8A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    4218 (RAB8A)
   04031 GTP-binding proteins [BR:hsa04031]
    4218 (RAB8A)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    4218 (RAB8A)
 Autophagy
  Other autophagy associated proteins
    4218 (RAB8A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    4218 (RAB8A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4218 (RAB8A)
  Exosomal proteins of other body fluids (saliva and urine)
   4218 (RAB8A)
  Exosomal proteins of colorectal cancer cells
   4218 (RAB8A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    4218 (RAB8A)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA SRPRB MMR_HSR1 GTP_EFTU Septin DUF3963 AAA_7 Phage_holin_6_1 AAA_16
Other DBs
NCBI-GeneID: 4218
NCBI-ProteinID: NP_005361
OMIM: 165040
HGNC: 7007
Ensembl: ENSG00000167461
Vega: OTTHUMG00000182238
Pharos: P61006(Tbio)
UniProt: P61006 A0A024R7I3
Structure
PDB: 

Position
19p13.11
AA seq 207 aa
MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ
IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG
NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN
SPQGSNQGVKITPDQQKRSSFFRCVLL
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg
aagacctgtgtcctgttccgcttctccgaggacgccttcaactccacttttatctccacc
ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaaactgcag
atatgggacacagccggtcaggaacggtttcggacgatcacaacggcctactacaggggt
gcaatgggcatcatgctggtctacgacatcaccaacgagaagtccttcgacaacatccgg
aactggattcgcaacattgaggagcacgcctctgcagacgtcgaaaagatgatactcggg
aacaagtgtgatgtgaatgacaagagacaagtttccaaggaacggggagaaaagctggcc
ctcgactatggaatcaagttcatggagaccagcgcgaaggccaacatcaatgtggaaaat
gcatttttcactctcgccagagatatcaaagcaaaaatggacaaaaaattggaaggcaac
agcccccaggggagcaaccagggagtcaaaatcacaccggaccagcagaagaggagcagc
tttttccgatgtgttcttctgtga

KEGG   Homo sapiens (human): 5874
Entry
5874              CDS       T01001                                 

Gene name
RAB27B, C25KG
Definition
(RefSeq) RAB27B, member RAS oncogene family
  KO
K07886  Ras-related protein Rab-27B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    5874 (RAB27B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5874 (RAB27B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5874 (RAB27B)
   04031 GTP-binding proteins [BR:hsa04031]
    5874 (RAB27B)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    5874 (RAB27B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5874 (RAB27B)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    5874 (RAB27B)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase MMR_HSR1 AAA_24 GTP_EFTU ATP_bind_1 AAA_22 TPP_enzyme_M Gtr1_RagA
Other DBs
NCBI-GeneID: 5874
NCBI-ProteinID: NP_004154
OMIM: 603869
HGNC: 9767
Ensembl: ENSG00000041353
Vega: OTTHUMG00000132710
Pharos: O00194(Tbio)
UniProt: O00194
Structure
PDB: 
2F7S

Position
18q21.2
AA seq 218 aa
MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNG
SSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQAN
AYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDL
IMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
NT seq 657 nt   +upstreamnt  +downstreamnt
atgaccgatggagactatgattatctgatcaaactcctggccctcggggattcaggggtg
gggaagacaacatttctttatagatacacagataataaattcaatcccaaattcatcact
acagtaggaatagactttcgggaaaaacgtgtggtttataatgcacaaggaccgaatgga
tcttcagggaaagcatttaaagtgcatcttcagctttgggacactgcgggacaagagcgg
ttccggagtctcaccactgcatttttcagagacgccatgggcttcttattaatgtttgac
ctcaccagtcaacagagcttcttaaatgtcagaaactggatgagccaactgcaagcaaat
gcttattgtgaaaatccagatatagtattaattggcaacaaggcagacctaccagatcag
agggaagtcaatgaacggcaagctcgggaactggctgacaaatatggcataccatatttt
gaaacaagtgcagcaactggacagaatgtggagaaagctgtagaaacccttttggactta
atcatgaagcgaatggaacagtgtgtggagaagacacaaatccctgatactgtcaatggt
ggaaattctggaaacttggatggggaaaagccaccagagaagaaatgtatctgctag

KEGG   Homo sapiens (human): 8766
Entry
8766              CDS       T01001                                 

Gene name
RAB11A, YL8
Definition
(RefSeq) RAB11A, member RAS oncogene family
  KO
K07904  Ras-related protein Rab-11A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04962  Vasopressin-regulated water reabsorption
hsa04972  Pancreatic secretion
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8766 (RAB11A)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    8766 (RAB11A)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    8766 (RAB11A)
   04961 Endocrine and other factor-regulated calcium reabsorption
    8766 (RAB11A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    8766 (RAB11A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8766 (RAB11A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8766 (RAB11A)
   04031 GTP-binding proteins [BR:hsa04031]
    8766 (RAB11A)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    8766 (RAB11A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8766 (RAB11A)
  Exosomal proteins of colorectal cancer cells
   8766 (RAB11A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    8766 (RAB11A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase AAA_22 GTP_EFTU AAA_16 PduV-EutP FeoB_N ABC_tran NTPase_1 Gtr1_RagA SRPRB TniB AAA_14 AAA_24 FAD-SLDH MCM AAA_5 AAA_21
Other DBs
NCBI-GeneID: 8766
NCBI-ProteinID: NP_004654
OMIM: 605570
HGNC: 9760
Ensembl: ENSG00000103769
Vega: OTTHUMG00000133162
Pharos: P62491(Tbio)
UniProt: P62491 A0A024R5Z8
Structure
PDB: 

Position
15q22.31
AA seq 216 aa
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQ
MSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI
NT seq 651 nt   +upstreamnt  +downstreamnt
atgggcacccgcgacgacgagtacgactacctctttaaagttgtccttattggagattct
ggtgttggaaagagtaatctcctgtctcgatttactcgaaatgagtttaatctggaaagc
aagagcaccattggagtagagtttgcaacaagaagcatccaggttgatggaaaaacaata
aaggcacagatatgggacacagcagggcaagagcgatatcgagctataacatcagcatat
tatcgtggagctgtaggtgccttattggtttatgacattgctaaacatctcacatatgaa
aatgtagagcgatggctgaaagaactgagagatcatgctgatagtaacattgttatcatg
cttgtgggcaataagagtgatctacgtcatctcagggcagttcctacagatgaagcaaga
gcttttgcagaaaagaatggtttgtcattcattgaaacttcggccctagactctacaaat
gtagaagctgcttttcagacaattttaacagagatttaccgcattgtttctcagaagcaa
atgtcagacagacgcgaaaatgacatgtctccaagcaacaatgtggttcctattcatgtt
ccaccaaccactgaaaacaagccaaaggtgcagtgctgtcagaacatctaa

KEGG   Homo sapiens (human): 9545
Entry
9545              CDS       T01001                                 

Gene name
RAB3D, D2-2, GOV, RAB16, RAD3D
Definition
(RefSeq) RAB3D, member RAS oncogene family
  KO
K07884  Ras-related protein Rab-3D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    9545 (RAB3D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9545 (RAB3D)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    9545 (RAB3D)
   04031 GTP-binding proteins [BR:hsa04031]
    9545 (RAB3D)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    9545 (RAB3D)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   9545 (RAB3D)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    9545 (RAB3D)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB MMR_HSR1 Gtr1_RagA GTP_EFTU AAA_16 CPT DUF2757
Other DBs
NCBI-GeneID: 9545
NCBI-ProteinID: NP_004274
OMIM: 604350
HGNC: 9779
Ensembl: ENSG00000105514
Vega: OTTHUMG00000180835
Pharos: O95716(Tbio)
UniProt: O95716 A0A024R7G2
Structure
PDB: 
2GF9

Position
19p13.2
AA seq 219 aa
MASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFK
VKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQI
KTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLV
DVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC
NT seq 660 nt   +upstreamnt  +downstreamnt
atggcatcagctggagacacccaggcaggcccacgggatgcagcagatcagaacttcgac
tatatgttcaaactgctactgataggcaacagcagtgtgggcaagacttccttcctgttc
cgatacgcggacgactccttcactcccgccttcgtcagtactgtgggcatcgatttcaag
gtcaagaccgtctaccgccatgacaagaggatcaagctgcagatctgggacacagcgggc
caggagcgctaccgcaccatcaccacggcctactaccggggagccatgggcttcctgctc
atgtatgacatcgccaatcaggaatcctttgccgctgtgcaggactgggccacgcaaatc
aagacctactcctgggacaacgcccaggtcatcctggtggggaacaagtgtgacctggag
gacgaacgtgttgtgcctgctgaggatggccggaggctcgccgacgaccttggtttcgag
ttctttgaagccagtgccaaggagaacatcaatgtgaagcaggtcttcgagcgcctggtg
gatgtcatctgcgagaagatgaacgagtccctggaacccagctccagctcaggcagcaac
gggaaaggcccggccgtgggggatgctccagccccccagcccagcagctgcagctgctag

DBGET integrated database retrieval system