KEGG   Homo sapiens (human): 4218Help
Entry
4218              CDS       T01001                                 

Gene name
RAB8A, MEL, RAB8
Definition
(RefSeq) RAB8A, member RAS oncogene family
  KO
K07901  Ras-related protein Rab-8A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04144  Endocytosis
hsa04152  AMPK signaling pathway
hsa04530  Tight junction
hsa04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    4218 (RAB8A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4218 (RAB8A)
   04140 Autophagy - animal
    4218 (RAB8A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    4218 (RAB8A)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    4218 (RAB8A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4218 (RAB8A)
   03036 Chromosome and associated proteins [BR:hsa03036]
    4218 (RAB8A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    4218 (RAB8A)
   04031 GTP-binding proteins [BR:hsa04031]
    4218 (RAB8A)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    4218 (RAB8A)
 Autophagy
  Other autophagy associated proteins
    4218 (RAB8A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    4218 (RAB8A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4218 (RAB8A)
  Exosomal proteins of other body fluids (saliva and urine)
   4218 (RAB8A)
  Exosomal proteins of colorectal cancer cells
   4218 (RAB8A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    4218 (RAB8A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA SRPRB MMR_HSR1 GTP_EFTU Septin DUF3963 AAA_7 AAA_16
Motif
Other DBs
NCBI-GeneID: 4218
NCBI-ProteinID: NP_005361
OMIM: 165040
HGNC: 7007
Ensembl: ENSG00000167461
Vega: OTTHUMG00000182238
Pharos: P61006(Tbio)
UniProt: P61006 A0A024R7I3
Structure
PDB: 

Position
19p13.11
AA seq 207 aa AA seqDB search
MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ
IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG
NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN
SPQGSNQGVKITPDQQKRSSFFRCVLL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg
aagacctgtgtcctgttccgcttctccgaggacgccttcaactccacttttatctccacc
ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaaactgcag
atatgggacacagccggtcaggaacggtttcggacgatcacaacggcctactacaggggt
gcaatgggcatcatgctggtctacgacatcaccaacgagaagtccttcgacaacatccgg
aactggattcgcaacattgaggagcacgcctctgcagacgtcgaaaagatgatactcggg
aacaagtgtgatgtgaatgacaagagacaagtttccaaggaacggggagaaaagctggcc
ctcgactatggaatcaagttcatggagaccagcgcgaaggccaacatcaatgtggaaaat
gcatttttcactctcgccagagatatcaaagcaaaaatggacaaaaaattggaaggcaac
agcccccaggggagcaaccagggagtcaaaatcacaccggaccagcagaagaggagcagc
tttttccgatgtgttcttctgtga

KEGG   Homo sapiens (human): 5874Help
Entry
5874              CDS       T01001                                 

Gene name
RAB27B, C25KG
Definition
(RefSeq) RAB27B, member RAS oncogene family
  KO
K07886  Ras-related protein Rab-27B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    5874 (RAB27B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5874 (RAB27B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5874 (RAB27B)
   04031 GTP-binding proteins [BR:hsa04031]
    5874 (RAB27B)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    5874 (RAB27B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5874 (RAB27B)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    5874 (RAB27B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf RsgA_GTPase MMR_HSR1 GTP_EFTU AAA_24 ATP_bind_1 AAA_22 Gtr1_RagA TPP_enzyme_M CENP-M
Motif
Other DBs
NCBI-GeneID: 5874
NCBI-ProteinID: NP_004154
OMIM: 603869
HGNC: 9767
Ensembl: ENSG00000041353
Vega: OTTHUMG00000132710
Pharos: O00194(Tbio)
UniProt: O00194
Structure
PDB: 

Position
18q21.2
AA seq 218 aa AA seqDB search
MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNG
SSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQAN
AYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDL
IMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatggagactatgattatctgatcaaactcctggccctcggggattcaggggtg
gggaagacaacatttctttatagatacacagataataaattcaatcccaaattcatcact
acagtaggaatagactttcgggaaaaacgtgtggtttataatgcacaaggaccgaatgga
tcttcagggaaagcatttaaagtgcatcttcagctttgggacactgcgggacaagagcgg
ttccggagtctcaccactgcatttttcagagacgccatgggcttcttattaatgtttgac
ctcaccagtcaacagagcttcttaaatgtcagaaactggatgagccaactgcaagcaaat
gcttattgtgaaaatccagatatagtattaattggcaacaaggcagacctaccagatcag
agggaagtcaatgaacggcaagctcgggaactggctgacaaatatggcataccatatttt
gaaacaagtgcagcaactggacagaatgtggagaaagctgtagaaacccttttggactta
atcatgaagcgaatggaacagtgtgtggagaagacacaaatccctgatactgtcaatggt
ggaaattctggaaacttggatggggaaaagccaccagagaagaaatgtatctgctag

KEGG   Homo sapiens (human): 8766Help
Entry
8766              CDS       T01001                                 

Gene name
RAB11A, YL8
Definition
(RefSeq) RAB11A, member RAS oncogene family
  KO
K07904  Ras-related protein Rab-11A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04962  Vasopressin-regulated water reabsorption
hsa04972  Pancreatic secretion
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8766 (RAB11A)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    8766 (RAB11A)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    8766 (RAB11A)
   04961 Endocrine and other factor-regulated calcium reabsorption
    8766 (RAB11A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    8766 (RAB11A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8766 (RAB11A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8766 (RAB11A)
   04031 GTP-binding proteins [BR:hsa04031]
    8766 (RAB11A)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    8766 (RAB11A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8766 (RAB11A)
  Exosomal proteins of colorectal cancer cells
   8766 (RAB11A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    8766 (RAB11A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase AAA_22 GTP_EFTU AAA_16 Gtr1_RagA FeoB_N ABC_tran PduV-EutP SRPRB AAA_14 AAA_24 TniB FAD-SLDH MCM AAA_7 AAA_5 AAA_21
Motif
Other DBs
NCBI-GeneID: 8766
NCBI-ProteinID: NP_004654
OMIM: 605570
HGNC: 9760
Ensembl: ENSG00000103769
Vega: OTTHUMG00000133162
Pharos: P62491(Tbio)
UniProt: P62491 A0A024R5Z8
Structure
PDB: 

Position
15q22.31
AA seq 216 aa AA seqDB search
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQ
MSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgggcacccgcgacgacgagtacgactacctctttaaagttgtccttattggagattct
ggtgttggaaagagtaatctcctgtctcgatttactcgaaatgagtttaatctggaaagc
aagagcaccattggagtagagtttgcaacaagaagcatccaggttgatggaaaaacaata
aaggcacagatatgggacacagcagggcaagagcgatatcgagctataacatcagcatat
tatcgtggagctgtaggtgccttattggtttatgacattgctaaacatctcacatatgaa
aatgtagagcgatggctgaaagaactgagagatcatgctgatagtaacattgttatcatg
cttgtgggcaataagagtgatctacgtcatctcagggcagttcctacagatgaagcaaga
gcttttgcagaaaagaatggtttgtcattcattgaaacttcggccctagactctacaaat
gtagaagctgcttttcagacaattttaacagagatttaccgcattgtttctcagaagcaa
atgtcagacagacgcgaaaatgacatgtctccaagcaacaatgtggttcctattcatgtt
ccaccaaccactgaaaacaagccaaaggtgcagtgctgtcagaacatctaa

KEGG   Homo sapiens (human): 9545Help
Entry
9545              CDS       T01001                                 

Gene name
RAB3D, D2-2, GOV, RAB16, RAD3D
Definition
(RefSeq) RAB3D, member RAS oncogene family
  KO
K07884  Ras-related protein Rab-3D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    9545 (RAB3D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9545 (RAB3D)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    9545 (RAB3D)
   04031 GTP-binding proteins [BR:hsa04031]
    9545 (RAB3D)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    9545 (RAB3D)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   9545 (RAB3D)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    9545 (RAB3D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA SRPRB MMR_HSR1 GTP_EFTU AAA_16 DUF2757
Motif
Other DBs
NCBI-GeneID: 9545
NCBI-ProteinID: NP_004274
OMIM: 604350
HGNC: 9779
Ensembl: ENSG00000105514
Vega: OTTHUMG00000180835
Pharos: O95716(Tbio)
UniProt: O95716 A0A024R7G2
Structure
PDB: 

Position
19p13.2
AA seq 219 aa AA seqDB search
MASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFK
VKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQI
KTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLV
DVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcatcagctggagacacccaggcaggcccacgggatgcagcagatcagaacttcgac
tatatgttcaaactgctactgataggcaacagcagtgtgggcaagacttccttcctgttc
cgatacgcggacgactccttcactcccgccttcgtcagtactgtgggcatcgatttcaag
gtcaagaccgtctaccgccatgacaagaggatcaagctgcagatctgggacacagcgggc
caggagcgctaccgcaccatcaccacggcctactaccggggagccatgggcttcctgctc
atgtatgacatcgccaatcaggaatcctttgccgctgtgcaggactgggccacgcaaatc
aagacctactcctgggacaacgcccaggtcatcctggtggggaacaagtgtgacctggag
gacgaacgtgttgtgcctgctgaggatggccggaggctcgccgacgaccttggtttcgag
ttctttgaagccagtgccaaggagaacatcaatgtgaagcaggtcttcgagcgcctggtg
gatgtcatctgcgagaagatgaacgagtccctggaacccagctccagctcaggcagcaac
gggaaaggcccggccgtgggggatgctccagccccccagcccagcagctgcagctgctag

DBGET integrated database retrieval system