KEGG   Homo sapiens (human): 4224Help
Entry
4224              CDS       T01001                                 

Gene name
MEP1A, PPHA
Definition
(RefSeq) meprin A subunit alpha
  KO
K01395  meprin A [EC:3.4.24.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    4224 (MEP1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    4224 (MEP1A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    4224 (MEP1A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.18  meprin A
     4224 (MEP1A)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   4224 (MEP1A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   4224 (MEP1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Astacin MAM EGF EGF_CA
Motif
Other DBs
NCBI-GeneID: 4224
NCBI-ProteinID: NP_005579
OMIM: 600388
HGNC: 7015
Ensembl: ENSG00000112818
Vega: OTTHUMG00000014790
Pharos: Q16819(Tbio)
UniProt: Q16819
Position
6p12.3
AA seq 746 aa AA seqDB search
MAWIRSTCILFFTLLFAHIAAVPIKYLPEENVHDADFGEQKDISEINLAAGLDLFQGDIL
LQKSRNGLRDPNTRWTFPIPYILADNLGLNAKGAILYAFEMFRLKSCVDFKPYEGESSYI
IFQQFDGCWSEVGDQHVGQNISIGQGCAYKAIIEHEILHALGFYHEQSRTDRDDYVNIWW
DQILSGYQHNFDTYDDSLITDLNTPYDYESLMHYQPFSFNKNASVPTITAKIPEFNSIIG
QRLDFSAIDLERLNRMYNCTTTHTLLDHCTFEKANICGMIQGTRDDTDWAHQDSAQAGEV
DHTLLGQCTGAGYFMQFSTSSGSAEEAALLESRILYPKRKQQCLQFFYKMTGSPSDRLVV
WVRRDDSTGNVRKLVKVQTFQGDDDHNWKIAHVVLKEEQKFRYLFQGTKGDPQNSTGGIY
LDDITLTETPCPTGVWTVRNFSQVLENTSKGDKLQSPRFYNSEGYGFGVTLYPNSRESSG
YLRLAFHVCSGENDAILEWPVENRQVIITILDQEPDVRNRMSSSMVFTTSKSHTSPAIND
TVIWDRPSRVGTYHTDCNCFRSIDLGWSGFISHQMLKRRSFLKNDDLIIFVDFEDITHLS
QTEVPTKGKRLSPQGLILQGQEQQVSEEGSGKAMLEEALPVSLSQGQPSRQKRSVENTGP
LEDHNWPQYFRDPCDPNPCQNDGICVNVKGMASCRCISGHAFFYTGERCQAVQVHGSVLG
MVIGGTAGVIFLTFSIIAILSQRPRK
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggcttggattagatccacttgcattctcttttttaccttgctttttgcccacatagca
gctgtaccgattaagtatcttcctgaagaaaatgtacatgatgcagattttggtgaacag
aaggatatttcagaaatcaatttagctgcaggcttggacctctttcaaggggacatcctc
ttgcagaaatccagaaatggcctgagagacccaaacaccaggtggacgttccccattcct
tacatcttggctgataatttggggctgaatgctaaaggagccattctgtatgcctttgag
atgttccgtctcaagtcctgtgtggatttcaagccctatgaaggagagagctcatatatc
atatttcaacagtttgatgggtgctggtctgaggttggtgaccaacatgtgggacagaac
atttccattggccaaggatgtgcctataaggccatcatagaacacgagatcctgcatgct
ttgggattttaccacgagcagtcaaggacggaccgggatgattatgtgaacatctggtgg
gaccaaattctttcaggttaccagcacaactttgacacctatgatgatagcttaatcaca
gacctcaatacaccctatgattatgagtctttgatgcactaccagcctttctcatttaac
aagaatgcaagtgttcccaccatcacagccaagatccctgagtttaactccattatcgga
cagcgcctggatttcagtgccattgatttagagaggctgaaccgaatgtacaattgcacc
acaactcacactcttttggaccactgtacttttgagaaggcaaacatctgtggaatgatt
cagggcaccagagatgacactgactgggcccatcaggacagtgctcaggctggagaagtg
gatcacaccttgttgggacaatgcacaggtgccggctacttcatgcagttcagcaccagc
tcggggtccgcggaagaggcagccctactggagtctcggattctttacccaaagaggaag
cagcagtgcctgcaatttttctataaaatgacgggaagtccttcagacagactcgttgtc
tgggtcaggagggatgacagcacaggcaatgttcgcaagttggtgaaggtgcagactttt
caaggagatgatgaccacaattggaaaattgcccatgtggtgctcaaagaggaacagaag
tttcgctaccttttccagggcacaaaaggcgaccctcagaactcaactgggggaatttac
ctagatgacatcactctgacagaaaccccctgccccacaggggtctggacagtccggaat
ttctcccaagtccttgagaacaccagcaaaggggacaagcttcagagccctcgattctac
aattcggagggatatggttttggggtaactttatacccaaatagcagagaaagctctggt
tacttgagacttgcttttcatgtgtgcagtggggagaacgatgctatcctggagtggccg
gtagaaaacagacaggtgataattaccatccttgaccaggagcctgatgtccggaacagg
atgtcctcaagcatggtgttcactacctcgaagtcgcacacatctccagcgataaatgac
actgtcatctgggacaggccgtccagggtgggaacctatcatacggactgtaattgtttt
agaagcatcgacttgggctggagtggtttcatttcccaccaaatgctgaaaaggaggagt
ttcctgaaaaatgatgacctcatcatatttgtggactttgaagatatcacccacctcagc
cagactgaagttcccactaaaggcaaaagactgagcccccaaggcctcattctccaaggc
caggagcagcaggtctccgaagaaggttcgggaaaggccatgttagaggaagccctacct
gtcagcctgagccaggggcagcccagccgacagaagcggtcggtggagaacacaggcccc
ctggaggaccataactggccacagtacttcagagacccatgtgacccaaacccttgccaa
aatgacggcatctgtgtgaacgtgaaggggatggcgagctgcaggtgcatctctggacat
gctttcttctacacgggggagcgctgtcaggccgtgcaggtgcacggcagtgtcctgggc
atggtgatcggaggcacggctggcgtgatcttcttgaccttctccatcatcgccatcctt
tcccaaaggccaaggaagtga

DBGET integrated database retrieval system