KEGG   Homo sapiens (human): 4236Help
Entry
4236              CDS       T01001                                 

Gene name
MFAP1, AMP
Definition
(RefSeq) microfibril associated protein 1
  KO
K13110  microfibrillar-associated protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    4236 (MFAP1)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Complex B specific factors
    4236 (MFAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFAP1
Motif
Other DBs
NCBI-GeneID: 4236
NCBI-ProteinID: NP_005917
OMIM: 600215
HGNC: 7032
Ensembl: ENSG00000140259
Vega: OTTHUMG00000060145
Pharos: P55081(Tbio)
UniProt: P55081
Structure
PDB: 

Position
15q15.3
AA seq 439 aa AA seqDB search
MSVPSALMKQPPIQSTAGAVPVRNEKGEISMEKVKVKRYVSGKRPDYAPMESSDEEDEEF
QFIKKAKEQEAEPEEQEEDSSSDPRLRRLQNRISEDVEERLARHRKIVEPEVVGESDSEV
EGDAWRMEREDSSEEEEEEIDDEEIERRRGMMRQRAQERKNEEMEVMEVEDEGRSGEESE
SESEYEEYTDSEDEMEPRLKPVFIRKKDRVTVQEREAEALKQKELEQEAKRMAEERRKYT
LKIVEEETKKELEENKRSLAALDALNTDDENDEEEYEAWKVRELKRIKRDREDREALEKE
KAEIERMRNLTEEERRAELRANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDF
SAPTLEDHFNKTILPKVMQVKNFGRSGRTKYTHLVDQDTTSFDSAWGQESAQNTKFFKQK
AAGVRDVFERPSAKKRKTT
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcccaagcgctctcatgaagcaaccgcccattcagtctacggctggggccgtc
ccagttcgcaatgagaaaggtgagatttcaatggaaaaagtgaaggtaaagcgttatgtg
tccggaaaaaggccagactatgcccctatggagtcctcagatgaggaggatgaagaattt
cagttcattaagaaagccaaagaacaagaagcagagcctgaggaacaggaggaggattca
tccagtgacccccggctacggcgtttacagaaccgtattagtgaagatgtggaagagaga
ttggctcgacatcgaaaaatagtggaacctgaagtggtaggagagagtgactcagaagta
gaaggagatgcttggcgcatggaacgagaagacagcagtgaagaagaggaggaggaaatt
gatgatgaggaaatagagcggcggcgtggcatgatgcgtcagcgagcacaggagagaaaa
aatgaagagatggaagtcatggaagtggaagatgagggtcgttctggagaggagtcagaa
tcagagtctgagtatgaagagtacacagacagtgaagatgagatggagcctcgccttaag
ccagtcttcattcgaaagaaggaccgagtgacagttcaagaacgtgaagccgaagcattg
aaacagaaggagctggagcaggaagcaaaacgcatggctgaggaaaggcgcaagtacaca
ctcaagattgtcgaagaggaaaccaaaaaagagctggaagagaacaagcgatccctggct
gcattggatgcactcaatactgatgatgaaaatgatgaggaggaatatgaggcatggaaa
gttcgagagctaaaaagaatcaagagggacagagaagatcgagaagcgcttgagaaggag
aaagcagaaattgaacgcatgcgaaacctgactgaggaagagaggagagctgaacttcgg
gcaaacggcaaagtcattaccaacaaagctgttaagggcaaatacaagttcttacagaag
tattatcaccggggtgccttcttcatggatgaggatgaagaagtatacaagagagatttc
agcgctcctaccctggaggatcatttcaataaaaccattcttcctaaagtcatgcaggtc
aagaactttggacgctcaggtcgcaccaaatacactcaccttgtggatcaagataccacc
tcctttgactcagcttggggccaagagagtgcccagaacacaaagttcttcaaacaaaag
gcagctggggtacgagatgtatttgagcggccatctgccaagaagcggaaaactacctag

DBGET integrated database retrieval system