KEGG   Homo sapiens (human): 4239
Entry
4239              CDS       T01001                                 
Symbol
MFAP4
Name
(RefSeq) microfibril associated protein 4
  KO
K25409  microfibrillar-associated protein 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    4239 (MFAP4)
SSDB
Motif
Pfam: Fibrinogen_C
Other DBs
NCBI-GeneID: 4239
NCBI-ProteinID: NP_002395
OMIM: 600596
HGNC: 7035
Ensembl: ENSG00000166482
Pharos: P55083(Tbio)
UniProt: P55083
Position
17:complement(19383445..19387190)
AA seq 255 aa
MKALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPS
GPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLL
TLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGAGDSLSYH
SGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKG
FYYSLKRTEMKIRRA
NT seq 768 nt   +upstreamnt  +downstreamnt
atgaaggcactcctggccctgccgctgctgctgcttctctccacgcccccgtgtgccccc
caggtctccgggatccgaggagatgctctggagaggttttgccttcagcaacccctggac
tgtgacgacatctatgcccagggctaccagtcagacggcgtgtacctcatctacccctcg
ggccccagtgtgcctgtgcccgtcttctgtgacatgaccaccgagggcgggaagtggacg
gttttccagaagagattcaatggctcagtaagtttcttccgcggctggaatgactacaag
ctgggcttcggccgtgctgatggagagtactggctggggctgcagaacatgcacctcctg
acactgaagcagaagtatgagctgcgagtggacttggaggactttgagaacaacacggcc
tatgccaagtacgctgacttctccatctccccgaacgcggtcagcgcagaggaggatggc
tacaccctctttgtggcaggctttgaggatggcggggcaggtgactccctgtcctaccac
agtggccagaagttctctaccttcgaccgggaccaggacctctttgtgcagaactgcgca
gctctctcctcaggagccttctggttccgcagctgccactttgccaacctcaatggcttc
tacctaggtggctcccacctctcttatgccaatggcatcaactgggcccagtggaagggc
ttctactactccctcaaacgcactgagatgaaaatccgccgggcctga

DBGET integrated database retrieval system