KEGG   Homo sapiens (human): 4241Help
Entry
4241              CDS       T01001                                 

Gene name
MELTF, CD228, MAP97, MFI2, MTF1, MTf
Definition
(RefSeq) melanotransferrin
  KO
K06569  melanoma-associated antigen p97
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    4241 (MELTF)
CD molecules [BR:hsa04090]
 Proteins
  4241 (MELTF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transferrin Phosphonate-bd
Motif
Other DBs
NCBI-GeneID: 4241
NCBI-ProteinID: NP_005920
OMIM: 155750
HGNC: 7037
Ensembl: ENSG00000163975
Vega: OTTHUMG00000155518
Pharos: P08582(Tbio)
UniProt: P08582
Position
3q29
AA seq 738 aa AA seqDB search
MRGPSGALWLLLALRTVLGGMEVRWCATSDPEQHKCGNMSEAFREAGIQPSLLCVRGTSA
DHCVQLIAAQEADAITLDGGAIYEAGKEHGLKPVVGEVYDQEVGTSYYAVAVVRRSSHVT
IDTLKGVKSCHTGINRTVGWNVPVGYLVESGRLSVMGCDVLKAVSDYFGGSCVPGAGETS
YSESLCRLCRGDSSGEGVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGKT
LPSWGQALLSQDFELLCRDGSRADVTEWRQCHLARVPAHAVVVRADTDGGLIFRLLNEGQ
RLFSHEGSSFQMFSSEAYGQKDLLFKDSTSELVPIATQTYEAWLGHEYLHAMKGLLCDPN
RLPPYLRWCVLSTPEIQKCGDMAVAFRRQRLKPEIQCVSAKSPQHCMERIQAEQVDAVTL
SGEDIYTAGKTYGLVPAAGEHYAPEDSSNSYYVVAVVRRDSSHAFTLDELRGKRSCHAGF
GSPAGWDVPVGALIQRGFIRPKDCDVLTAVSEFFNASCVPVNNPKNYPSSLCALCVGDEQ
GRNKCVGNSQERYYGYRGAFRCLVENAGDVAFVRHTTVFDNTNGHNSEPWAAELRSEDYE
LLCPNGARAEVSQFAACNLAQIPPHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFKM
FDSSNYHGQDLLFKDATVRAVPVGEKTTYRGWLGLDYVAALEGMSSQQCSGAAAPAPGAP
LLPLLLPALAARLLPPAL
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgcggggtccgagcggggctctgtggctgctcctggctctgcgcaccgtgctcggtggc
atggaggtgcggtggtgcgccacctcggacccagagcagcacaagtgcggcaacatgagc
gaggccttccgggaagcgggcatccagccctccctcctctgcgtccggggcacctccgcc
gaccactgcgtccagctcatcgcggcccaggaggctgacgccatcactctggatggagga
gccatctatgaggcgggaaaggagcacggcctgaagccggtggtgggcgaagtgtacgat
caagaggtcggtacctcctattacgccgtggctgtggtcaggaggagctcccatgtgacc
attgacaccctgaaaggcgtgaagtcctgccacacgggcatcaatcgcacagtgggctgg
aacgtgcccgtgggctacctggtggagagcggccgcctctcggtgatgggctgcgatgta
ctcaaagctgtcagcgactattttgggggcagctgcgtcccgggggcaggagagaccagt
tactctgagtccctctgtcgcctctgcaggggtgacagctctggggaaggggtgtgtgac
aagagccccctggagagatactacgactacagcggggccttccggtgcctggcggaaggg
gcaggggacgtggcttttgtgaagcacagcacggtactggagaacacggatgggaagacg
cttccctcctggggccaggccctgctgtcacaggacttcgagctgctgtgccgggatggt
agccgggccgatgtcaccgagtggaggcagtgccatctggcccgggtgcctgctcacgcc
gtggtggtccgggccgacacagatgggggcctcatcttccggctgctcaacgaaggccag
cgtctgttcagccacgagggcagcagcttccagatgttcagctctgaggcctatggccag
aaggatctactcttcaaagactctacctcggagcttgtgcccatcgccacacagacctat
gaggcgtggctgggccatgagtacctgcacgccatgaagggtctgctctgtgaccccaac
cggctgcccccctacctgcgctggtgtgtgctctccactcccgagatccagaagtgtgga
gacatggccgtggccttccgccggcagcggctcaagccagagatccagtgcgtgtcagcc
aagtccccccaacactgcatggagcggatccaggctgagcaggtcgacgctgtgaccctg
agtggcgaggacatttacacggcggggaagacgtacggcctggttcccgcagccggggag
cactatgccccggaagacagcagcaactcgtactacgtggtggccgtggtgagacgggac
agctcccacgccttcaccttggatgagcttcggggcaagcgctcctgccacgccggtttc
ggcagccctgcaggctgggatgtccccgtgggtgcccttattcagagaggcttcatccgg
cccaaggactgtgacgtcctcacagcagtgagcgagttcttcaatgccagctgcgtgccc
gtgaacaaccccaagaactacccctcctcgctgtgtgcactgtgcgtgggggacgagcag
ggccgcaacaagtgtgtgggcaacagccaggagcggtattacggctaccgcggcgccttc
aggtgcctggtggagaatgcgggtgacgttgccttcgtcaggcacacaaccgtctttgac
aacacaaacggccacaattccgagccctgggctgctgagctcaggtcagaggactatgaa
ctgctgtgccccaacggggcccgagccgaggtgtcccagtttgcagcctgcaacctggca
cagataccaccccacgccgtgatggtccggcccgacaccaacatcttcaccgtgtatgga
ctgctggacaaggcccaggacctgtttggagacgaccacaataagaacgggttcaaaatg
ttcgactcctccaactatcatggccaagacctgcttttcaaggatgccaccgtccgggcg
gtgcctgtcggagagaaaaccacctaccgcggctggctggggctggactacgtggcggcg
ctggaagggatgtcgtctcagcagtgctcgggcgcagcggccccggcgcccggggcgccc
ctgctcccgctgctgctgcccgccctcgccgcccgcctgctcccgcccgccctctga

DBGET integrated database retrieval system