KEGG   Homo sapiens (human): 4245Help
Entry
4245              CDS       T01001                                 

Gene name
MGAT1, GLCNAC-TI, GLCT1, GLYT1, GNT-1, GNT-I, GnTI, MGAT
Definition
(RefSeq) alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
  KO
K00726  alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.101]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa00513  Various types of N-glycan biosynthesis
hsa01100  Metabolic pathways
Network
nt06015  N-Glycan biosynthesis
  Element
N00820  N-Glycan biosynthesis
N00821  B4GALT1 deficiency in N-glycan biosynthesis
N00822  MGAT2 deficiency in N-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4245 (MGAT1)
   00513 Various types of N-glycan biosynthesis
    4245 (MGAT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    4245 (MGAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.101  alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     4245 (MGAT1)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  N-Glycan
   4245 (MGAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GNT-I Glyco_tranf_2_3
Motif
Other DBs
NCBI-GeneID: 4245
NCBI-ProteinID: NP_001108089
OMIM: 160995
HGNC: 7044
Ensembl: ENSG00000131446
Vega: OTTHUMG00000130937
Pharos: P26572(Tchem)
UniProt: P26572
Position
5q35.3
AA seq 445 aa AA seqDB search
MLKKQSAGLVLWGAILFVAWNALLLLFFWTRPAPGRPPSVSALDGDPASLTREVIRLAQD
AEVELERQRGLLQQIGDALSSQRGRVPTAAPPAQPRVPVTPAPAVIPILVIACDRSTVRR
CLDKLLHYRPSAELFPIIVSQDCGHEETAQAIASYGSAVTHIRQPDLSSIAVPPDHRKFQ
GYYKIARHYRWALGQVFRQFRFPAAVVVEDDLEVAPDFFEYFRATYPLLKADPSLWCVSA
WNDNGKEQMVDASRPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRQG
RACIRPEISRTMTFGRKGVSHGQFFDQHLKFIKLNQQFVHFTQLDLSYLQREAYDRDFLA
RVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIV
TFQFRGRRVHLAPPLTWEGYDPSWN
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagaagcagtctgcagggcttgtgctgtggggcgctatcctctttgtggcctgg
aatgccctgctgctcctcttcttctggacgcgcccagcacctggcaggccaccctcagtc
agcgctctcgatggcgaccccgccagcctcacccgggaagtgattcgcctggcccaagac
gccgaggtggagctggagcggcagcgtgggctgctgcagcagatcggggatgccctgtcg
agccagcgggggagggtgcccaccgcggcccctcccgcccagccgcgtgtgcctgtgacc
cccgcgccggcggtgattcccatcctggtcatcgcctgtgaccgcagcactgttcggcgc
tgcctggacaagctgctgcattatcggccctcggctgagctcttccccatcatcgttagc
caggactgcgggcacgaggagacggcccaggccatcgcctcctacggcagcgcggtcacg
cacatccggcagcccgacctgagcagcattgcggtgccgccggaccaccgcaagttccag
ggctactacaagatcgcgcgccactaccgctgggcgctgggccaggtcttccggcagttt
cgcttccccgcggccgtggtggtggaggatgacctggaggtggccccggacttcttcgag
tactttcgggccacctatccgctgctgaaggccgacccctccctgtggtgcgtctcggcc
tggaatgacaacggcaaggagcagatggtggacgccagcaggcctgagctgctctaccgc
accgactttttccctggcctgggctggctgctgttggccgagctctgggctgagctggag
cccaagtggccaaaggccttctgggacgactggatgcggcggccggagcagcggcagggg
cgggcctgcatacgccctgagatctcaagaacgatgacctttggccgcaagggtgtgagc
cacgggcagttctttgaccagcacctcaagtttatcaagctgaaccagcagtttgtgcac
ttcacccagctggacctgtcttacctgcagcgggaggcctatgaccgagatttcctcgcc
cgcgtctacggtgctccccagctgcaggtggagaaagtgaggaccaatgaccggaaggag
ctgggggaggtgcgggtgcagtatacgggcagggacagcttcaaggctttcgccaaggct
ctgggtgtcatggatgaccttaagtcgggggttccgagagctggctaccggggtattgtc
accttccagttccggggccgccgtgtccacctggcgcccccactgacgtgggagggctat
gatcctagctggaattag

DBGET integrated database retrieval system