KEGG   Homo sapiens (human): 4254Help
Entry
4254              CDS       T01001                                 

Gene name
KITLG, DCUA, DFNA69, FPH2, FPHH, KL-1, Kitl, MGF, SCF, SF, SHEP7, SLF
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04916  Melanogenesis
hsa05200  Pathways in cancer
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06275  Acute myeloid leukemia
  Element
N00045  KITLG-KIT-PI3K signaling pathway
N00215  KITLG-KIT-RAS-ERK signaling pathway
Disease
H00604  Deafness, autosomal dominant
H00884  Familial progressive hyperpigmentation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    4254 (KITLG)
   04015 Rap1 signaling pathway
    4254 (KITLG)
   04010 MAPK signaling pathway
    4254 (KITLG)
   04072 Phospholipase D signaling pathway
    4254 (KITLG)
   04151 PI3K-Akt signaling pathway
    4254 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    4254 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    4254 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4254 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    4254 (KITLG)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   4254 (KITLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SCF DUF4448
Motif
Other DBs
NCBI-GeneID: 4254
NCBI-ProteinID: NP_000890
OMIM: 184745
HGNC: 6343
Ensembl: ENSG00000049130
Vega: OTTHUMG00000169888
Pharos: P21583(Tbio)
UniProt: P21583 A0A024RBC0
Structure
PDB: 

Position
12q21.32
AA seq 273 aa AA seqDB search
MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPG
MDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSS
KDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVT
KPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKR
QPSLTRAVENIQINEEDNEISMLQEKEREFQEV
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattctcacttgcatttatcttcagctgctcctatttaat
cctctcgtcaaaactgaagggatctgcaggaatcgtgtgactaataatgtaaaagacgtc
actaaattggtggcaaatcttccaaaagactacatgataaccctcaaatatgtccccggg
atggatgttttgccaagtcattgttggataagcgagatggtagtacaattgtcagacagc
ttgactgatcttctggacaagttttcaaatatttctgaaggcttgagtaattattccatc
atagacaaacttgtgaatatagtggatgaccttgtggagtgcgtgaaagaaaactcatct
aaggatctaaaaaaatcattcaagagcccagaacccaggctctttactcctgaagaattc
tttagaatttttaatagatccattgatgccttcaaggactttgtagtggcatctgaaact
agtgattgtgtggtttcttcaacattaagtcctgagaaagattccagagtcagtgtcaca
aaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagcagt
aataggaaggccaaaaatccccctggagactccagcctacactgggcagccatggcattg
ccagcattgttttctcttataattggctttgcttttggagccttatactggaagaagaga
cagccaagtcttacaagggcagttgaaaatatacaaattaatgaagaggataatgagata
agtatgttgcaagagaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system