KEGG   Homo sapiens (human): 4255Help
Entry
4255              CDS       T01001                                 

Gene name
MGMT
Definition
(RefSeq) O-6-methylguanine-DNA methyltransferase
  KO
K00567  methylated-DNA-[protein]-cysteine S-methyltransferase [EC:2.1.1.63]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    4255 (MGMT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.63  methylated-DNA---[protein]-cysteine S-methyltransferase
     4255 (MGMT)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   Direct repair
    4255 (MGMT)
 Prokaryotic type
    4255 (MGMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_binding_1 Methyltransf_1N
Motif
Other DBs
NCBI-GeneID: 4255
NCBI-ProteinID: NP_002403
OMIM: 156569
HGNC: 7059
Ensembl: ENSG00000170430
Vega: OTTHUMG00000019261
UniProt: P16455 B4DEE8
Structure
PDB: 

Position
10q26.3
AA seq 207 aa AA seqDB search
MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLM
QCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAAL
AGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPG
LGGSSGLAGAWLKGAGATSGSPPAGRN
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggattgtgaaatgaaacgcaccacactggacagccctttggggaagctggag
ctgtctggttgtgagcagggtctgcacgaaataaagctcctgggcaaggggacgtctgca
gctgatgccgtggaggtcccagcccccgctgcggttctcggaggtccggagcccctgatg
cagtgcacagcctggctgaatgcctatttccaccagcccgaggctatcgaagagttcccc
gtgccggctcttcaccatcccgttttccagcaagagtcgttcaccagacaggtgttatgg
aagctgctgaaggttgtgaaattcggagaagtgatttcttaccagcaattagcagccctg
gcaggcaaccccaaagccgcgcgagcagtgggaggagcaatgagaggcaatcctgtcccc
atcctcatcccgtgccacagagtggtctgcagcagcggagccgtgggcaactactccgga
ggactggccgtgaaggaatggcttctggcccatgaaggccaccggttggggaagccaggc
ttgggagggagctcaggtctggcaggggcctggctcaagggagcgggagctacctcgggc
tccccgcctgctggccgaaactga

DBGET integrated database retrieval system