KEGG   Homo sapiens (human): 4261Help
Entry
4261              CDS       T01001                                 

Gene name
CIITA, C2TA, CIITAIV, MHC2TA, NLRA
Definition
(RefSeq) class II major histocompatibility complex transactivator
  KO
K08060  class II, major histocompatibility complex, transactivator
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05340  Primary immunodeficiency
Disease
H00093  Combined immunodeficiencies (CIDs)
H00985  Bare lymphocyte syndrome (BLS) type2
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    4261 (CIITA)
 09160 Human Diseases
  09162 Immune diseases
   05340 Primary immunodeficiency
    4261 (CIITA)
  09167 Infectious diseases
   05152 Tuberculosis
    4261 (CIITA)
   05164 Influenza A
    4261 (CIITA)
   05145 Toxoplasmosis
    4261 (CIITA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    4261 (CIITA)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   4261 (CIITA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT LRR_6 LRR_8 LRR_4 LRR_9
Motif
Other DBs
NCBI-GeneID: 4261
NCBI-ProteinID: NP_000237
OMIM: 600005
HGNC: 7067
Ensembl: ENSG00000179583
Vega: OTTHUMG00000129753
Pharos: P33076(Tbio)
UniProt: P33076 Q66X48 A0A0B4J1S1
Position
16p13.13
AA seq 1130 aa AA seqDB search
MRCLAPRPAGSYLSEPQGSSQCATMELGPLEGGYLELLNSDADPLCLYHFYDQMDLAGEE
EIELYSEPDTDTINCDQFSRLLCDMEGDEETREAYANIAELDQYVFQDSQLEGLSKDIFK
HIGPDEVIGESMEMPAEVGQKSQKRPFPEELPADLKHWKPAEPPTVVTGSLLVGPVSDCS
TLPCLPLPALFNQEPASGQMRLEKTDQIPMPFSSSSLSCLNLPEGPIQFVPTISTLPHGL
WQISEAGTGVSSIFIYHGEVPQASQVPPPSGFTVHGLPTSPDRPGSTSPFAPSATDLPSM
PEPALTSRANMTEHKTSPTQCPAAGEVSNKLPKWPEPVEQFYRSLQDTYGAEPAGPDGIL
VEVDLVQARLERSSSKSLERELATPDWAERQLAQGGLAEVLLAAKEHRRPRETRVIAVLG
KAGQGKSYWAGAVSRAWACGRLPQYDFVFSVPCHCLNRPGDAYGLQDLLFSLGPQPLVAA
DEVFSHILKRPDRVLLILDGFEELEAQDGFLHSTCGPAPAEPCSLRGLLAGLFQKKLLRG
CTLLLTARPRGRLVQSLSKADALFELSGFSMEQAQAYVMRYFESSGMTEHQDRALTLLRD
RPLLLSHSHSPTLCRAVCQLSEALLELGEDAKLPSTLTGLYVGLLGRAALDSPPGALAEL
AKLAWELGRRHQSTLQEDQFPSADVRTWAMAKGLVQHPPRAAESELAFPSFLLQCFLGAL
WLALSGEIKDKELPQYLALTPRKKRPYDNWLEGVPRFLAGLIFQPPARCLGALLGPSAAA
SVDRKQKVLARYLKRLQPGTLRARQLLELLHCAHEAEEAGIWQHVVQELPGRLSFLGTRL
TPPDAHVLGKALEAAGQDFSLDLRSTGICPSGLGSLVGLSCVTRFRAALSDTVALWESLQ
QHGETKLLQAAEEKFTIEPFKAKSLKDVEDLGKLVQTQRTRSSSEDTAGELPAVRDLKKL
EFALGPVSGPQAFPKLVRILTAFSSLQHLDLDALSENKIGDEGVSQLSATFPQLKSLETL
NLSQNNITDLGAYKLAEALPSLAASLLRLSLYNNCICDVGAESLARVLPDMVSLRVMDVQ
YNKFTAAGAQQLAASLRRCPHVETLAMWTPTIPFSVQEHLQQQDSRISLR
NT seq 3393 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgcctggctccacgccctgctgggtcctacctgtcagagccccaaggcagctca
cagtgtgccaccatggagttggggcccctagaaggtggctacctggagcttcttaacagc
gatgctgaccccctgtgcctctaccacttctatgaccagatggacctggctggagaagaa
gagattgagctctactcagaacccgacacagacaccatcaactgcgaccagttcagcagg
ctgttgtgtgacatggaaggtgatgaagagaccagggaggcttatgccaatatcgcggaa
ctggaccagtatgtcttccaggactcccagctggagggcctgagcaaggacattttcaag
cacataggaccagatgaagtgatcggtgagagtatggagatgccagcagaagttgggcag
aaaagtcagaaaagacccttcccagaggagcttccggcagacctgaagcactggaagcca
gctgagccccccactgtggtgactggcagtctcctagtgggaccagtgagcgactgctcc
accctgccctgcctgccactgcctgcgctgttcaaccaggagccagcctccggccagatg
cgcctggagaaaaccgaccagattcccatgcctttctccagttcctcgttgagctgcctg
aatctccctgagggacccatccagtttgtccccaccatctccactctgccccatgggctc
tggcaaatctctgaggctggaacaggggtctccagtatattcatctaccatggtgaggtg
ccccaggccagccaagtaccccctcccagtggattcactgtccacggcctcccaacatct
ccagaccggccaggctccaccagccccttcgctccatcagccactgacctgcccagcatg
cctgaacctgccctgacctcccgagcaaacatgacagagcacaagacgtcccccacccaa
tgcccggcagctggagaggtctccaacaagcttccaaaatggcctgagccggtggagcag
ttctaccgctcactgcaggacacgtatggtgccgagcccgcaggcccggatggcatccta
gtggaggtggatctggtgcaggccaggctggagaggagcagcagcaagagcctggagcgg
gaactggccaccccggactgggcagaacggcagctggcccaaggaggcctggctgaggtg
ctgttggctgccaaggagcaccggcggccgcgtgagacacgagtgattgctgtgctgggc
aaagctggtcagggcaagagctattgggctggggcagtgagccgggcctgggcttgtggc
cggcttccccagtacgactttgtcttctctgtcccctgccattgcttgaaccgtccgggg
gatgcctatggcctgcaggatctgctcttctccctgggcccacagccactcgtggcggcc
gatgaggttttcagccacatcttgaagagacctgaccgcgttctgctcatcctagacggc
ttcgaggagctggaagcgcaagatggcttcctgcacagcacgtgcggaccggcaccggcg
gagccctgctccctccgggggctgctggccggccttttccagaagaagctgctccgaggt
tgcaccctcctcctcacagcccggccccggggccgcctggtccagagcctgagcaaggcc
gacgccctatttgagctgtccggcttctccatggagcaggcccaggcatacgtgatgcgc
tactttgagagctcagggatgacagagcaccaagacagagccctgacgctcctccgggac
cggccacttcttctcagtcacagccacagccctactttgtgccgggcagtgtgccagctc
tcagaggccctgctggagcttggggaggacgccaagctgccctccacgctcacgggactc
tatgtcggcctgctgggccgtgcagccctcgacagcccccccggggccctggcagagctg
gccaagctggcctgggagctgggccgcagacatcaaagtaccctacaggaggaccagttc
ccatccgcagacgtgaggacctgggcgatggccaaaggcttagtccaacacccaccgcgg
gccgcagagtccgagctggccttccccagcttcctcctgcaatgcttcctgggggccctg
tggctggctctgagtggcgaaatcaaggacaaggagctcccgcagtacctagcattgacc
ccaaggaagaagaggccctatgacaactggctggagggcgtgccacgctttctggctggg
ctgatcttccagcctcccgcccgctgcctgggagccctactcgggccatcggcggctgcc
tcggtggacaggaagcagaaggtgcttgcgaggtacctgaagcggctgcagccggggaca
ctgcgggcgcggcagctgctggagctgctgcactgcgcccacgaggccgaggaggctgga
atttggcagcacgtggtacaggagctccccggccgcctctcttttctgggcacccgcctc
acgcctcctgatgcacatgtactgggcaaggccttggaggcggcgggccaagacttctcc
ctggacctccgcagcactggcatttgcccctctggattggggagcctcgtgggactcagc
tgtgtcacccgtttcagggctgccttgagcgacacggtggcgctgtgggagtccctgcag
cagcatggggagaccaagctacttcaggcagcagaggagaagttcaccatcgagcctttc
aaagccaagtccctgaaggatgtggaagacctgggaaagcttgtgcagactcagaggacg
agaagttcctcggaagacacagctggggagctccctgctgttcgggacctaaagaaactg
gagtttgcgctgggccctgtctcaggcccccaggctttccccaaactggtgcggatcctc
acggccttttcctccctgcagcatctggacctggatgcgctgagtgagaacaagatcggg
gacgagggtgtctcgcagctctcagccaccttcccccagctgaagtccttggaaaccctc
aatctgtcccagaacaacatcactgacctgggtgcctacaaactcgccgaggccctgcct
tcgctcgctgcatccctgctcaggctaagcttgtacaataactgcatctgcgacgtggga
gccgagagcttggctcgtgtgcttccggacatggtgtccctccgggtgatggacgtccag
tacaacaagttcacggctgccggggcccagcagctcgctgccagccttcggaggtgtcct
catgtggagacgctggcgatgtggacgcccaccatcccattcagtgtccaggaacacctg
caacaacaggattcacggatcagcctgagatga

DBGET integrated database retrieval system