KEGG   Homo sapiens (human): 4267Help
Entry
4267              CDS       T01001                                 

Gene name
CD99, HBA71, MIC2, MIC2X, MIC2Y, MSK5X
Definition
(RefSeq) CD99 molecule (Xg blood group)
  KO
K06520  CD99 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    4267 (CD99)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    4267 (CD99)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    4267 (CD99)
CD molecules [BR:hsa04090]
 Proteins
  4267 (CD99)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD99L2 TctA
Motif
Other DBs
NCBI-GeneID: 4267
NCBI-ProteinID: NP_002405
OMIM: 313470 450000
HGNC: 7082
Ensembl: ENSG00000002586
Vega: OTTHUMG00000021073
Pharos: P14209(Tbio)
UniProt: P14209
Position
Xp22.33 and Yp11.2
AA seq 185 aa AA seqDB search
MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVV
DGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEE
ADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQR
TLLEK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcggggctgcgctggcgctgctgctcttcggcctgctgggtgttctggtcgcc
gccccggatggtggtttcgatttatccgatgcccttcctgacaatgaaaacaagaaaccc
actgcaatccccaagaaacccagtgctggggatgactttgacttaggagatgctgttgtt
gatggagaaaatgacgacccacgaccaccgaacccacccaaaccgatgccaaatccaaac
cccaaccaccctagttcctccggtagcttttcagatgctgaccttgcggatggcgtttca
ggtggagaaggaaaaggaggcagtgatggtggaggcagccacaggaaagaaggggaagag
gccgacgccccaggcgtgatccccgggattgtgggggctgtcgtggtcgccgtggctgga
gccatctctagcttcattgcttaccagaaaaagaagctatgcttcaaagaaaatgcagaa
caaggggaggtggacatggagagccaccggaatgccaacgcagagccagctgttcagcgt
actcttttagagaaatag

DBGET integrated database retrieval system