KEGG   Homo sapiens (human): 4277Help
Entry
4277              CDS       T01001                                 

Gene name
MICB, PERB11.2
Definition
(RefSeq) MHC class I polypeptide-related sequence B
  KO
K07985  MHC class I-related protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
N00185  KSHV MIR2 to cell surface molecule-endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    4277 (MICB)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    4277 (MICB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 Ig_2
Motif
Other DBs
NCBI-GeneID: 4277
NCBI-ProteinID: NP_005922
OMIM: 602436
HGNC: 7091
Ensembl: ENSG00000204516
Vega: OTTHUMG00000031074
Pharos: Q29980(Tbio)
UniProt: Q29980 X6R344
Structure
PDB: 

Position
6p21.33
AA seq 383 aa AA seqDB search
MGLGRVLLFLAVAFPFAPPAAAAEPHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYD
RQKRRAKPQGQWAENVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCE
IHEDSSTRGSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHY
RAMQADCLQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWR
QDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKA
LVLQSQRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGPELVSLQVLDQHPVGTGDHR
DAAQLGFQPLMSATGSTGSTEGT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggggctgggccgggtcctgctgtttctggccgtcgccttcccttttgcacccccggca
gccgccgctgagccccacagtcttcgttacaacctcatggtgctgtcccaggatggatct
gtgcagtcagggtttctcgctgagggacatctggatggtcagcccttcctgcgctatgac
aggcagaaacgcagggcaaagccccagggacagtgggcagaaaatgtcctgggagctaag
acctgggacacagagaccgaggacttgacagagaatgggcaagacctcaggaggaccctg
actcatatcaaggaccagaaaggaggcttgcattccctccaggagattagggtctgtgag
atccatgaagacagcagcaccaggggctcccggcatttctactacgatggggagctcttc
ctctcccaaaacctggagactcaagaatcgacagtgccccagtcctccagagctcagacc
ttggctatgaacgtcacaaatttctggaaggaagatgccatgaagaccaagacacactat
cgcgctatgcaggcagactgcctgcagaaactacagcgatatctgaaatccggggtggcc
atcaggagaacagtgccccccatggtgaatgtcacctgcagcgaggtctcagagggcaac
atcaccgtgacatgcagggcttccagcttctatccccggaatatcacactgacctggcgt
caggatggggtatctttgagccacaacacccagcagtggggggatgtcctgcctgatggg
aatggaacctaccagacctgggtggccaccaggattcgccaaggagaggagcagaggttc
acctgctacatggaacacagcgggaatcacggcactcaccctgtgccctctgggaaggcg
ctggtgcttcagagtcaacggacagactttccatatgtttctgctgctatgccatgtttt
gttattattattattctctgtgtcccttgttgcaagaagaaaacatcagcggcagagggt
ccagagcttgtgagcctgcaggtcctggatcaacacccagttgggacaggagaccacagg
gatgcagcacagctgggatttcagcctctgatgtcagctactgggtccactggttccact
gagggcacctag

DBGET integrated database retrieval system