KEGG   Homo sapiens (human): 4288
Entry
4288              CDS       T01001                                 

Gene name
MKI67, KIA, MIB-, MIB-1, PPP1R105
Definition
(RefSeq) marker of proliferation Ki-67
  KO
K17582  antigen KI-67
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    4288 (MKI67)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4288 (MKI67)
SSDB
Motif
Pfam: KI67R FHA PP1_bind Yop-YscD_cpl
Other DBs
NCBI-GeneID: 4288
NCBI-ProteinID: NP_002408
OMIM: 176741
HGNC: 7107
Ensembl: ENSG00000148773
Vega: OTTHUMG00000019255
Pharos: P46013(Tbio)
UniProt: P46013
Structure
PDB: 
5J28 2AFF 1R21

Position
10q26.2
AA seq 3256 aa
MWPTRRLVTIKRSGVDGPHFPLSLSTCLFGRGIECDIRIQLPVVSKQHCKIEIHEQEAIL
HNFSSTNPTQVNGSVIDEPVRLKHGDVITIIDRSFRYENESLQNGRKSTEFPRKIREQEP
ARRVSRSSFSSDPDEKAQDSKAYSKITEGKVSGNPQVHIKNVKEDSTADDSKDSVAQGTT
NVHSSEHAGRNGRNAADPISGDFKEISSVKLVSRYGELKSVPTTQCLDNSKKNESPFWKL
YESVKKELDVKSQKENVLQYCRKSGLQTDYATEKESADGLQGETQLLVSRKSRPKSGGSG
HAVAEPASPEQELDQNKGKGRDVESVQTPSKAVGASFPLYEPAKMKTPVQYSQQQNSPQK
HKNKDLYTTGRRESVNLGKSEGFKAGDKTLTPRKLSTRNRTPAKVEDAADSATKPENLSS
KTRGSIPTDVEVLPTETEIHNEPFLTLWLTQVERKIQKDSLSKPEKLGTTAGQMCSGLPG
LSSVDINNFGDSINESEGIPLKRRRVSFGGHLRPELFDENLPPNTPLKRGEAPTKRKSLV
MHTPPVLKKIIKEQPQPSGKQESGSEIHVEVKAQSLVISPPAPSPRKTPVASDQRRRSCK
TAPASSSKSQTEVPKRGGRKSGNLPSKRVSISRSQHDILQMICSKRRSGASEANLIVAKS
WADVVKLGAKQTQTKVIKHGPQRSMNKRQRRPATPKKPVGEVHSQFSTGHANSPCTIIIG
KAHTEKVHVPARPYRVLNNFISNQKMDFKEDLSGIAEMFKTPVKEQPQLTSTCHIAISNS
ENLLGKQFQGTDSGEEPLLPTSESFGGNVFFSAQNAAKQPSDKCSASPPLRRQCIRENGN
VAKTPRNTYKMTSLETKTSDTETEPSKTVSTANRSGRSTEFRNIQKLPVESKSEETNTEI
VECILKRGQKATLLQQRREGEMKEIERPFETYKENIELKENDEKMKAMKRSRTWGQKCAP
MSDLTDLKSLPDTELMKDTARGQNLLQTQDHAKAPKSEKGKITKMPCQSLQPEPINTPTH
TKQQLKASLGKVGVKEELLAVGKFTRTSGETTHTHREPAGDGKSIRTFKESPKQILDPAA
RVTGMKKWPRTPKEEAQSLEDLAGFKELFQTPGPSEESMTDEKTTKIACKSPPPESVDTP
TSTKQWPKRSLRKADVEEEFLALRKLTPSAGKAMLTPKPAGGDEKDIKAFMGTPVQKLDL
AGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVD
TPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPKPSVGEEKDIIIFVGTPVQKL
DLTENLTGSKRRPQTPKEEAQALEDLTGFKELFQTPGHTEEAVAAGKTTKMPCESSPPES
ADTPTSTRRQPKTPLEKRDVQKELSALKKLTQTSGETTHTDKVPGGEDKSINAFRETAKQ
KLDPAASVTGSKRHPKTKEKAQPLEDLAGLKELFQTPVCTDKPTTHEKTTKIACRSQPDP
VDTPTSSKPQSKRSLRKVDVEEEFFALRKRTPSAGKAMHTPKPAVSGEKNIYAFMGTPVQ
KLDLTENLTGSKRRLQTPKEKAQALEDLAGFKELFQTRGHTEESMTNDKTAKVACKSSQP
DPDKNPASSKRRLKTSLGKVGVKEELLAVGKLTQTSGETTHTHTEPTGDGKSMKAFMESP
KQILDSAASLTGSKRQLRTPKGKSEVPEDLAGFIELFQTPSHTKESMTNEKTTKVSYRAS
QPDLVDTPTSSKPQPKRSLRKADTEEEFLAFRKQTPSAGKAMHTPKPAVGEEKDINTFLG
TPVQKLDQPGNLPGSNRRLQTRKEKAQALEELTGFRELFQTPCTDNPTTDEKTTKKILCK
SPQSDPADTPTNTKQRPKRSLKKADVEEEFLAFRKLTPSAGKAMHTPKAAVGEEKDINTF
VGTPVEKLDLLGNLPGSKRRPQTPKEKAKALEDLAGFKELFQTPGHTEESMTDDKITEVS
CKSPQPDPVKTPTSSKQRLKISLGKVGVKEEVLPVGKLTQTSGKTTQTHRETAGDGKSIK
AFKESAKQMLDPANYGTGMERWPRTPKEEAQSLEDLAGFKELFQTPDHTEESTTDDKTTK
IACKSPPPESMDTPTSTRRRPKTPLGKRDIVEELSALKQLTQTTHTDKVPGDEDKGINVF
RETAKQKLDPAASVTGSKRQPRTPKGKAQPLEDLAGLKELFQTPICTDKPTTHEKTTKIA
CRSPQPDPVGTPTIFKPQSKRSLRKADVEEESLALRKRTPSVGKAMDTPKPAGGDEKDMK
AFMGTPVQKLDLPGNLPGSKRWPQTPKEKAQALEDLAGFKELFQTPGTDKPTTDEKTTKI
ACKSPQPDPVDTPASTKQRPKRNLRKADVEEEFLALRKRTPSAGKAMDTPKPAVSDEKNI
NTFVETPVQKLDLLGNLPGSKRQPQTPKEKAEALEDLVGFKELFQTPGHTEESMTDDKIT
EVSCKSPQPESFKTSRSSKQRLKIPLVKVDMKEEPLAVSKLTRTSGETTQTHTEPTGDSK
SIKAFKESPKQILDPAASVTGSRRQLRTRKEKARALEDLVDFKELFSAPGHTEESMTIDK
NTKIPCKSPPPELTDTATSTKRCPKTRPRKEVKEELSAVERLTQTSGQSTHTHKEPASGD
EGIKVLKQRAKKKPNPVEEEPSRRRPRAPKEKAQPLEDLAGFTELSETSGHTQESLTAGK
ATKIPCESPPLEVVDTTASTKRHLRTRVQKVQVKEEPSAVKFTQTSGETTDADKEPAGED
KGIKALKESAKQTPAPAASVTGSRRRPRAPRESAQAIEDLAGFKDPAAGHTEESMTDDKT
TKIPCKSSPELEDTATSSKRRPRTRAQKVEVKEELLAVGKLTQTSGETTHTDKEPVGEGK
GTKAFKQPAKRKLDAEDVIGSRRQPRAPKEKAQPLEDLASFQELSQTPGHTEELANGAAD
SFTSAPKQTPDSGKPLKISRRVLRAPKVEPVGDVVSTRDPVKSQSKSNTSLPPLPFKRGG
GKDGSVTGTKRLRCMPAPEEIVEELPASKKQRVAPRARGKSSEPVVIMKRSLRTSAKRIE
PAEELNSNDMKTNKEEHKLQDSVPENKGISLRSRRQNKTEAEQQITEVFVLAERIEINRN
EKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAK
VLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNV
CVKKIRTRSHRDSEDI
NT seq 9771 nt   +upstreamnt  +downstreamnt
atgtggcccacgagacgcctggttactatcaaaaggagcggggtcgacggtccccacttt
cccctgagcctcagcacctgcttgtttggaaggggtattgaatgtgacatccgtatccag
cttcctgttgtgtcaaaacaacattgcaaaattgaaatccatgagcaggaggcaatatta
cataatttcagttccacaaatccaacacaagtaaatgggtctgttattgatgagcctgta
cggctaaaacatggagatgtaataactattattgatcgttccttcaggtatgaaaatgaa
agtcttcagaatggaaggaagtcaactgaatttccaagaaaaatacgtgaacaggagcca
gcacgtcgtgtctcaagatctagcttctcttctgaccctgatgagaaagctcaagattcc
aaggcctattcaaaaatcactgaaggaaaagtttcaggaaatcctcaggtacatatcaag
aatgtcaaagaagacagtaccgcagatgactcaaaagacagtgttgctcagggaacaact
aatgttcattcctcagaacatgctggacgtaatggcagaaatgcagctgatcccatttct
ggggattttaaagaaatttccagcgttaaattagtgagccgttatggagaattgaagtct
gttcccactacacaatgtcttgacaatagcaaaaaaaatgaatctcccttttggaagctt
tatgagtcagtgaagaaagagttggatgtaaaatcacaaaaagaaaatgtcctacagtat
tgtagaaaatctggattacaaactgattacgcaacagagaaagaaagtgctgatggttta
cagggggagacccaactgttggtctcgcgtaagtcaagaccaaaatctggtgggagcggc
cacgctgtggcagagcctgcttcacctgaacaagagcttgaccagaacaaggggaaggga
agagacgtggagtctgttcagactcccagcaaggctgtgggcgccagctttcctctctat
gagccggctaaaatgaagacccctgtacaatattcacagcaacaaaattctccacaaaaa
cataagaacaaagacctgtatactactggtagaagagaatctgtgaatctgggtaaaagt
gaaggcttcaaggctggtgataaaactcttactcccaggaagctttcaactagaaatcga
acaccagctaaagttgaagatgcagctgactctgccactaagccagaaaatctctcttcc
aaaaccagaggaagtattcctacagatgtggaagttctgcctacggaaactgaaattcac
aatgagccatttttaactctgtggctcactcaagttgagaggaagatccaaaaggattcc
ctcagcaagcctgagaaattgggcactacagctggacagatgtgctctgggttacctggt
cttagttcagttgatatcaacaactttggtgattccattaatgagagtgagggaatacct
ttgaaaagaaggcgtgtgtcctttggtgggcacctaagacctgaactatttgatgaaaac
ttgcctcctaatacgcctctcaaaaggggagaagccccaaccaaaagaaagtctctggta
atgcacactccacctgtcctgaagaaaatcatcaaggaacagcctcaaccatcaggaaaa
caagagtcaggttcagaaatccatgtggaagtgaaggcacaaagcttggttataagccct
ccagctcctagtcctaggaaaactccagttgccagtgatcaacgccgtaggtcctgcaaa
acagcccctgcttccagcagcaaatctcagacagaggttcctaagagaggagggagaaag
agtggcaacctgccttcaaagagagtgtctatcagccgaagtcaacatgatattttacag
atgatatgttccaaaagaagaagtggtgcttcggaagcaaatctgattgttgcaaaatca
tgggcagatgtagtaaaacttggtgcaaaacaaacacaaactaaagtcataaaacatggt
cctcaaaggtcaatgaacaaaaggcaaagaagacctgctactccaaagaagcctgtgggc
gaagttcacagtcaatttagtacaggccacgcaaactctccttgtaccataataataggg
aaagctcatactgaaaaagtacatgtgcctgctcgaccctacagagtgctcaacaacttc
atttccaaccaaaaaatggactttaaggaagatctttcaggaatagctgaaatgttcaag
accccagtgaaggagcaaccgcagttgacaagcacatgtcacatcgctatttcaaattca
gagaatttgcttggaaaacagtttcaaggaactgattcaggagaagaacctctgctcccc
acctcagagagttttggaggaaatgtgttcttcagtgcacagaatgcagcaaaacagcca
tctgataaatgctctgcaagccctcccttaagacggcagtgtattagagaaaatggaaac
gtagcaaaaacgcccaggaacacctacaaaatgacttctctggagacaaaaacttcagat
actgagacagagccttcaaaaacagtatccactgcaaacaggtcaggaaggtctacagag
ttcaggaatatacagaagctacctgtggaaagtaagagtgaagaaacaaatacagaaatt
gttgagtgcatcctaaaaagaggtcagaaggcaacactactacaacaaaggagagaagga
gagatgaaggaaatagaaagaccttttgagacatataaggaaaatattgaattaaaagaa
aacgatgaaaagatgaaagcaatgaagagatcaagaacttgggggcagaaatgtgcacca
atgtctgacctgacagacctcaagagcttgcctgatacagaactcatgaaagacacggca
cgtggccagaatctcctccaaacccaagatcatgccaaggcaccaaagagtgagaaaggc
aaaatcactaaaatgccctgccagtcattacaaccagaaccaataaacaccccaacacac
acaaaacaacagttgaaggcatccctggggaaagtaggtgtgaaagaagagctcctagca
gtcggcaagttcacacggacgtcaggggagaccacgcacacgcacagagagccagcagga
gatggcaagagcatcagaacgtttaaggagtctccaaagcagatcctggacccagcagcc
cgtgtaactggaatgaagaagtggccaagaacgcctaaggaagaggcccagtcactagaa
gacctggctggcttcaaagagctcttccagacaccaggtccctctgaggaatcaatgact
gatgagaaaactaccaaaatagcctgcaaatctccaccaccagaatcagtggacactcca
acaagcacaaagcaatggcctaagagaagtctcaggaaagcagatgtagaggaagaattc
ttagcactcaggaaactaacaccatcagcagggaaagccatgcttacgcccaaaccagca
ggaggtgatgagaaagacattaaagcatttatgggaactccagtgcagaaactggacctg
gcaggaactttacctggcagcaaaagacagctacagactcctaaggaaaaggcccaggct
ctagaagacctggctggctttaaagagctcttccagactcctggtcacaccgaggaatta
gtggctgctggtaaaaccactaaaataccctgcgactctccacagtcagacccagtggac
accccaacaagcacaaagcaacgacccaagagaagtatcaggaaagcagatgtagaggga
gaactcttagcgtgcaggaatctaatgccatcagcaggcaaagccatgcacacgcctaaa
ccatcagtaggtgaagagaaagacatcatcatatttgtgggaactccagtgcagaaactg
gacctgacagagaacttaaccggcagcaagagacggccacaaactcctaaggaagaggcc
caggctctggaagacctgactggctttaaagagctcttccagacccctggtcatactgaa
gaagcagtggctgctggcaaaactactaaaatgccctgcgaatcttctccaccagaatca
gcagacaccccaacaagcacaagaaggcagcccaagacacctttggagaaaagggacgta
cagaaggagctctcagccctgaagaagctcacacagacatcaggggaaaccacacacaca
gataaagtaccaggaggtgaggataaaagcatcaacgcgtttagggaaactgcaaaacag
aaactggacccagcagcaagtgtaactggtagcaagaggcacccaaaaactaaggaaaag
gcccaacccctagaagacctggctggcttgaaagagctcttccagacaccagtatgcact
gacaagcccacgactcacgagaaaactaccaaaatagcctgcagatcacaaccagaccca
gtggacacaccaacaagctccaagccacagtccaagagaagtctcaggaaagtggacgta
gaagaagaattcttcgcactcaggaaacgaacaccatcagcaggcaaagccatgcacaca
cccaaaccagcagtaagtggtgagaaaaacatctacgcatttatgggaactccagtgcag
aaactggacctgacagagaacttaactggcagcaagagacggctacaaactcctaaggaa
aaggcccaggctctagaagacctggctggctttaaagagctcttccagacacgaggtcac
actgaggaatcaatgactaacgataaaactgccaaagtagcctgcaaatcttcacaacca
gacccagacaaaaacccagcaagctccaagcgacggctcaagacatccctggggaaagtg
ggcgtgaaagaagagctcctagcagttggcaagctcacacagacatcaggagagactaca
cacacacacacagagccaacaggagatggtaagagcatgaaagcatttatggagtctcca
aagcagatcttagactcagcagcaagtctaactggcagcaagaggcagctgagaactcct
aagggaaagtctgaagtccctgaagacctggccggcttcatcgagctcttccagacacca
agtcacactaaggaatcaatgactaacgaaaaaactaccaaagtatcctacagagcttca
cagccagacctagtggacaccccaacaagctccaagccacagcccaagagaagtctcagg
aaagcagacactgaagaagaatttttagcatttaggaaacaaacgccatcagcaggcaaa
gccatgcacacacccaaaccagcagtaggtgaagagaaagacatcaacacgtttttggga
actccagtgcagaaactggaccagccaggaaatttacctggcagcaatagacggctacaa
actcgtaaggaaaaggcccaggctctagaagaactgactggcttcagagagcttttccag
acaccatgcactgataaccccacgactgatgagaaaactaccaaaaaaatactctgcaaa
tctccgcaatcagacccagcggacaccccaacaaacacaaagcaacggcccaagagaagc
ctcaagaaagcagacgtagaggaagaatttttagcattcaggaaactaacaccatcagca
ggcaaagccatgcacacgcctaaagcagcagtaggtgaagagaaagacatcaacacattt
gtggggactccagtggagaaactggacctgctaggaaatttacctggcagcaagagacgg
ccacaaactcctaaagaaaaggccaaggctctagaagatctggctggcttcaaagagctc
ttccagacaccaggtcacactgaggaatcaatgaccgatgacaaaatcacagaagtatcc
tgcaaatctccacaaccagacccagtcaaaaccccaacaagctccaagcaacgactcaag
atatccttggggaaagtaggtgtgaaagaagaggtcctaccagtcggcaagctcacacag
acgtcagggaagaccacacagacacacagagagacagcaggagatggaaagagcatcaaa
gcgtttaaggaatctgcaaagcagatgctggacccagcaaactatggaactgggatggag
aggtggccaagaacacctaaggaagaggcccaatcactagaagacctggccggcttcaaa
gagctcttccagacaccagaccacactgaggaatcaacaactgatgacaaaactaccaaa
atagcctgcaaatctccaccaccagaatcaatggacactccaacaagcacaaggaggcgg
cccaaaacacctttggggaaaagggatatagtggaagagctctcagccctgaagcagctc
acacagaccacacacacagacaaagtaccaggagatgaggataaaggcatcaacgtgttc
agggaaactgcaaaacagaaactggacccagcagcaagtgtaactggtagcaagaggcag
ccaagaactcctaagggaaaagcccaacccctagaagacttggctggcttgaaagagctc
ttccagacaccaatatgcactgacaagcccacgactcatgagaaaactaccaaaatagcc
tgcagatctccacaaccagacccagtgggtaccccaacaatcttcaagccacagtccaag
agaagtctcaggaaagcagacgtagaggaagaatccttagcactcaggaaacgaacacca
tcagtagggaaagctatggacacacccaaaccagcaggaggtgatgagaaagacatgaaa
gcatttatgggaactccagtgcagaaattggacctgccaggaaatttacctggcagcaaa
agatggccacaaactcctaaggaaaaggcccaggctctagaagacctggctggcttcaaa
gagctcttccagacaccaggcactgacaagcccacgactgatgagaaaactaccaaaata
gcctgcaaatctccacaaccagacccagtggacaccccagcaagcacaaagcaacggccc
aagagaaacctcaggaaagcagacgtagaggaagaatttttagcactcaggaaacgaaca
ccatcagcaggcaaagccatggacacaccaaaaccagcagtaagtgatgagaaaaatatc
aacacatttgtggaaactccagtgcagaaactggacctgctaggaaatttacctggcagc
aagagacagccacagactcctaaggaaaaggctgaggctctagaggacctggttggcttc
aaagaactcttccagacaccaggtcacactgaggaatcaatgactgatgacaaaatcaca
gaagtatcctgtaaatctccacagccagagtcattcaaaacctcaagaagctccaagcaa
aggctcaagatacccctggtgaaagtggacatgaaagaagagcccctagcagtcagcaag
ctcacacggacatcaggggagactacgcaaacacacacagagccaacaggagatagtaag
agcatcaaagcgtttaaggagtctccaaagcagatcctggacccagcagcaagtgtaact
ggtagcaggaggcagctgagaactcgtaaggaaaaggcccgtgctctagaagacctggtt
gacttcaaagagctcttctcagcaccaggtcacactgaagagtcaatgactattgacaaa
aacacaaaaattccctgcaaatctcccccaccagaactaacagacactgccacgagcaca
aagagatgccccaagacacgtcccaggaaagaagtaaaagaggagctctcagcagttgag
aggctcacgcaaacatcagggcaaagcacacacacacacaaagaaccagcaagcggtgat
gagggcatcaaagtattgaagcaacgtgcaaagaagaaaccaaacccagtagaagaggaa
cccagcaggagaaggccaagagcacctaaggaaaaggcccaacccctggaagacctggcc
ggcttcacagagctctctgaaacatcaggtcacactcaggaatcactgactgctggcaaa
gccactaaaataccctgcgaatctcccccactagaagtggtagacaccacagcaagcaca
aagaggcatctcaggacacgtgtgcagaaggtacaagtaaaagaagagccttcagcagtc
aagttcacacaaacatcaggggaaaccacggatgcagacaaagaaccagcaggtgaagat
aaaggcatcaaagcattgaaggaatctgcaaaacagacaccggctccagcagcaagtgta
actggcagcaggagacggccaagagcacccagggaaagtgcccaagccatagaagaccta
gctggcttcaaagacccagcagcaggtcacactgaagaatcaatgactgatgacaaaacc
actaaaataccctgcaaatcatcaccagaactagaagacaccgcaacaagctcaaagaga
cggcccaggacacgtgcccagaaagtagaagtgaaggaggagctgttagcagttggcaag
ctcacacaaacctcaggggagaccacgcacaccgacaaagagccggtaggtgagggcaaa
ggcacgaaagcatttaagcaacctgcaaagcggaagctggacgcagaagatgtaattggc
agcaggagacagccaagagcacctaaggaaaaggcccaacccctggaagatctggccagc
ttccaagagctctctcaaacaccaggccacactgaggaactggcaaatggtgctgctgat
agctttacaagcgctccaaagcaaacacctgacagtggaaaacctctaaaaatatccaga
agagttcttcgggcccctaaagtagaacccgtgggagacgtggtaagcaccagagaccct
gtaaaatcacaaagcaaaagcaacacttccctgcccccactgcccttcaagaggggaggt
ggcaaagatggaagcgtcacgggaaccaagaggctgcgctgcatgccagcaccagaggaa
attgtggaggagctgccagccagcaagaagcagagggttgctcccagggcaagaggcaaa
tcatccgaacccgtggtcatcatgaagagaagtttgaggacttctgcaaaaagaattgaa
cctgcggaagagctgaacagcaacgacatgaaaaccaacaaagaggaacacaaattacaa
gactcggtccctgaaaataagggaatatccctgcgctccagacgccaaaataagactgag
gcagaacagcaaataactgaggtctttgtattagcagaaagaatagaaataaacagaaat
gaaaagaagcccatgaagacctccccagagatggacattcagaatccagatgatggagcc
cggaaacccatacctagagacaaagtcactgagaacaaaaggtgcttgaggtctgctaga
cagaatgagagctcccagcctaaggtggcagaggagagcggagggcagaagagtgcgaag
gttctcatgcagaatcagaaagggaaaggagaagcaggaaattcagactccatgtgcctg
agatcaagaaagacaaaaagccagcctgcagcaagcactttggagagcaaatctgtgcag
agagtaacgcggagtgtcaagaggtgtgcagaaaatccaaagaaggctgaggacaatgtg
tgtgtcaagaaaataagaaccagaagtcatagggacagtgaagatatttga

DBGET integrated database retrieval system