KEGG   Homo sapiens (human): 4293Help
Entry
4293              CDS       T01001                                 

Gene name
MAP3K9, MEKK9, MLK1, PRKE1
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 9
  KO
K04417  mitogen-activated protein kinase kinase kinase 9 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4293 (MAP3K9)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     4293 (MAP3K9)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  MLK family
   4293 (MAP3K9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr SH3_9 SH3_1 SH3_2 Pkinase_fungal OmpH GvpL_GvpF
Motif
Other DBs
NCBI-GeneID: 4293
NCBI-ProteinID: NP_001271159
OMIM: 600136
HGNC: 6861
Ensembl: ENSG00000006432
Vega: OTTHUMG00000171249
Pharos: P80192(Tchem)
UniProt: P80192 Q8NEB1
Structure
PDB: 

Position
14q24.2
AA seq 1104 aa AA seqDB search
MEPSRALLGCLASAAAAAPPGEDGAGAGAEEEEEEEEEAAAAVGPGELGCDAPLPYWTAV
FEYEAAGEDELTLRLGDVVEVLSKDSQVSGDEGWWTGQLNQRVGIFPSNYVTPRSAFSSR
CQPGGEDPSCYPPIQLLEIDFAELTLEEIIGIGGFGKVYRAFWIGDEVAVKAARHDPDED
ISQTIENVRQEAKLFAMLKHPNIIALRGVCLKEPNLCLVMEFARGGPLNRVLSGKRIPPD
ILVNWAVQIARGMNYLHDEAIVPIIHRDLKSSNILILQKVENGDLSNKILKITDFGLARE
WHRTTKMSAAGTYAWMAPEVIRASMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYG
VAMNKLALPIPSTCPEPFAKLMEDCWNPDPHSRPSFTNILDQLTTIEESGFFEMPKDSFH
CLQDNWKHEIQEMFDQLRAKEKELRTWEEELTRAALQQKNQEELLRRREQELAEREIDIL
ERELNIIIHQLCQEKPRVKKRKGKFRKSRLKLKDGNRISLPSDFQHKFTVQASPTMDKRK
SLINSRSSPPASPTIIPRLRAIQLTPGESSKTWGRSSVVPKEEGEEEEKRAPKKKGRTWG
PGTLGQKELASGDEGSPQRREKANGLSTPSESPHFHLGLKSLVDGYKQWSSSAPNLVKGP
RSSPALPGFTSLMEMEDEDSEGPGSGESRLQHSPSQSYLCIPFPRGEDGDGPSSDGIHEE
PTPVNSATSTPQLTPTNSLKRGGAHHRRCEVALLGCGAVLAATGLGFDLLEAGKCQLLPL
EEPEPPAREEKKRREGLFQRSSRPRRSTSPPSRKLFKKEEPMLLLGDPSASLTLLSLSSI
SECNSTRSLLRSDSDEIVVYEMPVSPVEAPPLSPCTHNPLVNVRVERFKRDPNQSLTPTH
VTLTTPSQPSSHRRTPSDGALKPETLLASRSPSSNGLSPSPGAGMLKTPSPSRDPGEFPR
LPDPNVVFPPTPRRWNTQQDSTLERPKTLEFLPRPRPSANRQRLDPWWFVSPSHARSTSP
ANSSSTETPSNLDSCFASSSSTVEERPGLPALLPFQAGPLPPTERTLLDLDAEGQSQDST
VPLCRAELNTHRPAPYEIQQEFWS
NT seq 3315 nt NT seq  +upstreamnt  +downstreamnt
atggagccctccagagcgcttctcggctgcctagcgagcgccgccgctgccgccccgccg
ggggaggatggagcaggggccggggccgaggaggaggaggaggaggaggaggaggcggcg
gcggcggtgggccccggggagctgggctgcgacgcgccgctgccctactggacggccgtg
ttcgagtacgaggcggcgggcgaggacgagctgaccctgcggctgggcgacgtggtggag
gtgctgtccaaggactcgcaggtgtccggcgacgagggctggtggaccgggcagctgaac
cagcgggtgggcatcttccccagcaactacgtgaccccgcgcagcgccttctccagccgc
tgccagcccggcggcgaggaccccagttgctacccgcccattcagttgttagaaattgat
tttgcggagctcaccttggaagagattattggcatcgggggctttgggaaggtctatcgt
gctttctggataggggatgaggttgctgtgaaagcagctcgccacgaccctgatgaggac
atcagccagaccatagagaatgttcgccaagaggccaagctcttcgccatgctgaagcac
cccaacatcattgccctaagaggggtatgtctgaaggagcccaacctctgcttggtcatg
gagtttgctcgtggaggacctttgaatagagtgttatctgggaaaaggattcccccagac
atcctggtgaattgggctgtgcagattgccagagggatgaactacttacatgatgaggca
attgttcccatcatccaccgcgaccttaagtccagcaacatattgatcctccagaaggtg
gagaatggagacctgagcaacaagattctgaagatcactgattttggcctggctcgggaa
tggcaccgaaccaccaagatgagtgcggcagggacgtatgcttggatggcacccgaagtc
atccgggcctccatgttttccaaaggcagtgatgtgtggagctatggggtgctactttgg
gagttgctgactggtgaggtgccctttcgaggcattgatggcttagcagtcgcttatgga
gtggccatgaacaaactcgcccttcctattccttctacgtgcccagaaccttttgccaaa
ctcatggaagactgctggaatcctgatccccactcacgaccatctttcacgaatatcctg
gaccagctaaccaccatagaggagtctggtttctttgaaatgcccaaggactccttccac
tgcctgcaggacaactggaaacacgagattcaggagatgtttgaccaactcagggccaaa
gaaaaggaacttcgcacctgggaggaggagctgacgcgggctgcactgcagcagaagaac
caggaggaactgctgcggcgtcgggagcaggagctggccgagcgggagattgacatcctg
gaacgggagctcaacatcatcatccaccagctgtgccaggagaagccccgggtgaagaaa
cgcaagggcaagttcaggaagagccggctgaagctcaaggatggcaaccgcatcagcctc
ccttctgatttccagcacaagttcacggtgcaggcctcccctaccatggataaaaggaag
agtcttatcaacagccgctccagtcctcctgcaagccccaccatcattcctcgccttcga
gccatccagttgacaccaggtgaaagcagcaaaacctggggcaggagctcagtcgtccca
aaggaggaaggggaggaggaggagaagagggccccaaagaagaagggacggacgtggggg
ccagggacgcttggtcagaaggagcttgcctcgggagatgaaggatcccctcagagacgt
gagaaagctaatggtttaagtaccccatcagaatctccacatttccacttgggcctcaag
tccctggtagatggatataagcagtggtcgtccagtgcccccaacctggtgaagggccca
aggagtagcccggccctgccagggttcaccagccttatggagatggaggatgaggacagt
gaaggcccagggagtggagagagtcgcctacagcattcacccagccagtcctacctctgt
atcccattccctcgtggagaggatggcgatggcccctccagtgatggaatccatgaggag
cccaccccagtcaactcggccacgagtacccctcagctgacgccaaccaacagcctcaag
cggggcggtgcccaccaccgccgctgcgaggtggctctgctcggctgtggggctgttctg
gcagccacaggcctagggtttgacttgctggaagctggcaagtgccagctgcttcccctg
gaggagcctgagccaccagcccgggaggagaagaaaagacgggagggtctttttcagagg
tccagccgtcctcgtcggagcaccagccccccatcccgaaagcttttcaagaaggaggag
cccatgctgttgctaggagacccctctgcctccctgacgctgctctccctctcctccatc
tccgagtgcaactccacacgctccctgctgcgctccgacagcgatgaaattgtcgtgtat
gagatgccagtcagcccagtcgaggcccctcccctgagtccatgtacccacaaccccctg
gtcaatgtccgagtagagcgcttcaaacgagatcctaaccaatctctgactcccacccat
gtcaccctcaccaccccctcgcagcccagcagtcaccggcggactccttctgatggggcc
cttaagccagagactctcctagccagcaggagcccctccagcaatgggttgagccccagt
cctggagcaggaatgttgaaaacccccagtcccagccgagacccaggtgaattcccccgt
ctccctgaccccaatgtggtcttccccccaaccccaaggcgctggaacactcagcaggac
tctaccttggagagacccaagactctggagtttctgcctcggccgcgtccttctgccaac
cggcaacggctggacccttggtggtttgtgtcccccagccatgcccgcagcacctcccca
gccaacagctccagcacagagacgcccagcaacctggactcctgctttgctagcagtagc
agcactgtagaggagcggcctggacttccagccctgctcccgttccaggcagggccgctg
cccccgactgagcggacgctcctggacctggatgcagaggggcagagtcaggacagcacc
gtgccgctgtgcagagcggaactgaacacacacaggcctgccccttatgagatccagcag
gagttctggtcttag

DBGET integrated database retrieval system