KEGG   Homo sapiens (human): 4295
Entry
4295              CDS       T01001                                 

Gene name
MLN
Definition
(RefSeq) motilin
  KO
K05265  motilin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4295 (MLN)
SSDB
Motif
Pfam: Motilin_ghrelin Motilin_assoc
Other DBs
NCBI-GeneID: 4295
NCBI-ProteinID: NP_002409
OMIM: 158270
HGNC: 7141
Ensembl: ENSG00000096395
Vega: OTTHUMG00000014536
Pharos: P12872(Tbio)
CPD: C16047
UniProt: P12872
Position
6p21.31
AA seq 115 aa
MVSRKAVAALLVVHVAAMLASQTEAFVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEE
GPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK
NT seq 348 nt   +upstreamnt  +downstreamnt
atggtatcccgtaaggctgtggctgctctgctggtggtgcatgtagctgccatgctggcc
tcccagacggaagccttcgtccccatcttcacctatggcgaactccagaggatgcaggaa
aaggaacggaataaagggcaaaagaaatccctgagtgtatggcagaggtctggggaggaa
ggtcctgtagaccctgcggagcccatcagggaagaagaaaacgaaatgatcaagctgact
gctcctctggaaattggaatgaggatgaactccagacagctggaaaagtacccggccacc
ctggaagggctgctgagtgagatgcttccccagcatgcagccaagtga

DBGET integrated database retrieval system