KEGG   Homo sapiens (human): 4306Help
Entry
4306              CDS       T01001                                 

Gene name
NR3C2, MCR, MLR, MR, NR3C2VIT
Definition
(RefSeq) nuclear receptor subfamily 3 group C member 2
  KO
K08555  mineralocorticoid receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04960  Aldosterone-regulated sodium reabsorption
Disease
H00243  Hyperkalemic distal renal tubular acidosis (RTA type 4)
H00603  Hypertension exacerbated in pregnancy
H01633  High blood pressure
Drug target
Aldosterone: D10528
Canrenone: D03363
Desoxycortone (DG00507): D03698 D03699 D07792
Dicirenone: D03792
Drospirenone: D03917
Eplerenone: D01115
Finerenone: D10633
Fludrocortisone (DG00506): D00986 D07967
Mexrenoate potassium: D05020
Potassium canrenoate: D01943
Prorenoate potassium: D05640
Spironolactone: D00443
Spiroxasone: D05912
Triamterene: D00386
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    4306 (NR3C2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4306 (NR3C2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    4306 (NR3C2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    4306 (NR3C2)
Nuclear receptors [BR:hsa03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   4306 (NR3C2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4
Motif
Other DBs
NCBI-GeneID: 4306
NCBI-ProteinID: NP_000892
OMIM: 600983
HGNC: 7979
Ensembl: ENSG00000151623
Vega: OTTHUMG00000161455
Pharos: P08235(Tclin)
UniProt: P08235 B0ZBF6
Structure
PDB: 

Position
4q31.23
AA seq 984 aa AA seqDB search
METKGYHSLPEGLDMERRWGQVSQAVERSSLGPTERTDENNYMEIVNVSCVSGAIPNNST
QGSSKEKQELLPCLQQDNNRPGILTSDIKTELESKELSATVAESMGLYMDSVRDADYSYE
QQNQQGSMSPAKIYQNVEQLVKFYKGNGHRPSTLSCVNTPLRSFMSDSGSSVNGGVMRAV
VKSPIMCHEKSPSVCSPLNMTSSVCSPAGINSVSSTTASFGSFPVHSPITQGTPLTCSPN
VENRGSRSHSPAHASNVGSPLSSPLSSMKSSISSPPSHCSVKSPVSSPNNVTLRSSVSSP
ANINNSRCSVSSPSNTNNRSTLSSPAASTVGSICSPVNNAFSYTASGTSAGSSTLRDVVP
SPDTQEKGAQEVPFPKTEEVESAISNGVTGQLNIVQYIKPEPDGAFSSSCLGGNSKINSD
SSFSVPIKQESTKHSCSGTSFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPGF
DGNCEGSGFPVGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSAR
DQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPS
KICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRL
QKCLQAGMNLGARKSKKLGKLKGIHEEQPQQQQPPPPPPPPQSPEEGTTYIAPAKEPSVN
TALVPQLSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQV
VKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKM
HQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYI
KELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAML
VEIISDQLPKVESGNAKPLYFHRK
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atggagaccaaaggctaccacagtctccctgaaggtctagatatggaaagacggtggggt
caagtttctcaggctgtggagcgttcttccctgggacctacagagaggaccgatgagaat
aactacatggagattgtcaacgtaagctgtgtttccggtgctattccaaacaacagtact
caaggaagcagcaaagaaaaacaagaactactcccttgccttcagcaagacaataatcgg
cctgggattttaacatctgatattaaaactgagctggaatctaaggaactttcagcaact
gtagctgagtccatgggtttatatatggattctgtaagagatgctgactattcctatgag
cagcagaaccaacaaggaagcatgagtccagctaagatttatcagaatgttgaacagctg
gtgaaattttacaaaggaaatggccatcgtccttccactctaagttgtgtgaacacgccc
ttgagatcatttatgtctgactctgggagctccgtgaatggtggcgtcatgcgcgccgtt
gttaaaagccctatcatgtgtcatgagaaaagcccgtctgtttgcagccctctgaacatg
acatcttcggtttgcagccctgctggaatcaactctgtgtcctccaccacagccagcttt
ggcagttttccagtgcacagcccaatcacccagggaactcctctgacatgctcccctaat
gttgaaaatcgaggctccaggtcgcacagccctgcacatgctagcaatgtgggctctcct
ctctcaagtccgttaagtagcatgaaatcctcaatttccagccctccaagtcactgcagt
gtaaaatctccagtctccagtcccaataatgtcactctgagatcctctgtgtctagccct
gcaaatattaacaactcaaggtgctctgtttccagcccttcgaacactaataacagatcc
acgctttccagtccggcagccagtactgtgggatctatctgtagccctgtaaacaatgcc
ttcagctacactgcttctggcacctctgctggatccagtacattgcgggatgtggttccc
agtccagacacgcaggagaaaggtgctcaagaggtcccttttcctaagactgaggaagta
gagagtgccatctcaaatggtgtgactggccagcttaatattgtccagtacataaaacca
gaaccagatggagcttttagcagctcatgtctaggaggaaatagcaaaataaattcggat
tcttcattctcagtaccaataaagcaagaatcaaccaagcattcatgttcaggcacctct
tttaaagggaatccaacagtaaacccgtttccatttatggatggctcgtatttttccttt
atggatgataaagactattattccctatcaggaattttaggaccacctgtgcccggcttt
gatggtaactgtgaaggcagcggattcccagtgggtattaaacaagaaccagatgatggg
agctattacccagaggccagcatcccttcctctgctattgttggggtgaattcaggtgga
cagtccttccactacaggattggtgctcaaggtacaatatctttatcacgatcggctaga
gaccaatctttccaacacctgagttcctttcctcctgtcaatactttagtggagtcatgg
aaatcacacggcgacctgtcgtctagaagaagtgatgggtatccggtcttagaatacatt
ccagaaaatgtatcaagctctactttacgaagtgtttctactggatcttcaagaccttca
aaaatatgtttggtgtgtggggatgaggcttcaggatgccattatggggtagtcacctgt
ggcagctgcaaagttttcttcaaaagagcagtggaagggcaacacaactatttatgtgct
ggaagaaatgattgcatcattgataagattcgacgaaagaattgtcctgcttgcagactt
cagaaatgtcttcaagctggaatgaatttaggagcacgaaagtcaaagaagttgggaaag
ttaaaagggattcacgaggagcagccacagcagcagcagcccccacccccacccccaccc
ccgcaaagcccagaggaagggacaacgtacatcgctcctgcaaaagaaccctcggtcaac
acagcactggttcctcagctctccacaatctcacgagcgctcacaccttcccccgttatg
gtccttgaaaacattgaacctgaaattgtatatgcaggctatgacagctcaaaaccagat
acagccgaaaatctgctctccacgctcaaccgcttagcaggcaaacagatgatccaagtc
gtgaagtgggcaaaggtacttccaggatttaaaaacttgcctcttgaggaccaaattacc
ctaatccagtattcttggatgtgtctatcatcatttgccttgagctggagatcgtacaaa
catacgaacagccaatttctctattttgcaccagacctagtctttaatgaagagaagatg
catcagtctgccatgtatgaactatgccaggggatgcaccaaatcagccttcagttcgtt
cgactgcagctcacctttgaagaatacaccatcatgaaagttttgctgctactaagcaca
attccaaaggatggcctcaaaagccaggctgcatttgaagaaatgaggacaaattacatc
aaagaactgaggaagatggtaactaagtgtcccaacaattctgggcagagctggcagagg
ttctaccaactgaccaagctgctggactccatgcatgacctggtgagcgacctgctggaa
ttctgcttctacaccttccgagagtcccatgcgctgaaggtagagttccccgcaatgctg
gtggagatcatcagcgaccagctgcccaaggtggagtcggggaacgccaagccgctctac
ttccaccggaagtga

DBGET integrated database retrieval system