KEGG   Homo sapiens (human): 4308
Entry
4308              CDS       T01001                                 

Gene name
TRPM1, CSNB1C, LTRPC1, MLSN1
Definition
(RefSeq) transient receptor potential cation channel subfamily M member 1
  KO
K04976  transient receptor potential cation channel subfamily M member 1
Organism
hsa  Homo sapiens (human)
Disease
H00787  Congenital stationary night blindness
H01877  Chromosome 15q13.3 microdeletion syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    4308 (TRPM1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   4308 (TRPM1)
SSDB
Motif
Pfam: LSDAT_euk TRPM_tetra Ion_trans LSDAT_prok
Other DBs
NCBI-GeneID: 4308
NCBI-ProteinID: NP_002411
OMIM: 603576
HGNC: 7146
Ensembl: ENSG00000134160
Vega: OTTHUMG00000129267
Pharos: Q7Z4N2(Tbio)
UniProt: Q7Z4N2
Position
15q13.3
AA seq 1603 aa
MKDSNRCCCGQFTNQHIPPLPSATPSKNEEESKQVETQPEKWSVAKHTQSYPTDSYGVLE
FQGGGYSNKAMYIRVSYDTKPDSLLHLMVKDWQLELPKLLISVHGGLQNFEMQPKLKQVF
GKGLIKAAMTTGAWIFTGGVSTGVISHVGDALKDHSSKSRGRVCAIGIAPWGIVENKEDL
VGKDVTRVYQTMSNPLSKLSVLNNSHTHFILADNGTLGKYGAEVKLRRLLEKHISLQKIN
TRLGQGVPLVGLVVEGGPNVVSIVLEYLQEEPPIPVVICDGSGRASDILSFAHKYCEEGG
IINESLREQLLVTIQKTFNYNKAQSHQLFAIIMECMKKKELVTVFRMGSEGQQDIEMAIL
TALLKGTNVSAPDQLSLALAWNRVDIARSQIFVFGPHWPPLGSLAPPTDSKATEKEKKPP
MATTKGGRGKGKGKKKGKVKEEVEEETDPRKIELLNWVNALEQAMLDALVLDRVDFVKLL
IENGVNMQHFLTIPRLEELYNTRLGPPNTLHLLVRDVKKSNLPPDYHISLIDIGLVLEYL
MGGAYRCNYTRKNFRTLYNNLFGPKRPKALKLLGMEDDEPPAKGKKKKKKKKEEEIDIDV
DDPAVSRFQYPFHELMVWAVLMKRQKMAVFLWQRGEESMAKALVACKLYKAMAHESSESD
LVDDISQDLDNNSKDFGQLALELLDQSYKHDEQIAMKLLTYELKNWSNSTCLKLAVAAKH
RDFIAHTCSQMLLTDMWMGRLRMRKNPGLKVIMGILLPPTILFLEFRTYDDFSYQTSKEN
EDGKEKEEENTDANADAGSRKGDEENEHKKQRSIPIGTKICEFYNAPIVKFWFYTISYLG
YLLLFNYVILVRMDGWPSLQEWIVISYIVSLALEKIREILMSEPGKLSQKIKVWLQEYWN
ITDLVAISTFMIGAILRLQNQPYMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIG
KMMIDMLYFVVIMLVVLMSFGVARQAILHPEEKPSWKLARNIFYMPYWMIYGEVFADQID
LYAMEINPPCGENLYDEEGKRLPPCIPGAWLTPALMACYLLVANILLVNLLIAVFNNTFF
EVKSISNQVWKFQRYQLIMTFHDRPVLPPPMIILSHIYIIIMRLSGRCRKKREGDQEERD
RGLKLFLSDEELKRLHEFEEQCVQEHFREKEDEQQSSSDERIRVTSERVENMSMRLEEIN
ERETFMKTSLQTVDLRLAQLEELSNRMVNALENLAGIDRSDLIQARSRASSECEATYLLR
QSSINSADGYSLYRYHFNGEELLFEDTSLSTSPGTGVRKKTCSFRIKEEKDVKTHLVPEC
QNSLHLSLGTSTSATPDGSHLAVDDLKNAEESKLGPDIGISKEDDERQTDSKKEETISPS
LNKTDVIHGQDKSDVQNTQLTVETTNIEGTISYPLEETKITRYFPDETINACKTMKSRSF
VYSRGRKLVGGVNQDVEYSSITDQQLTTEWQCQVQKITRSHSTDIPYIVSEAAVQAEHKE
QFADMQDEHHVAEAIPRIPRLSLTITDRNGMENLLSVKPDQTLGFPSLRSKSLHGHPRNV
KSIQGKLDRSGHASSVSSLVIVSGMTAEEKKVKKEKASTETEC
NT seq 4812 nt   +upstreamnt  +downstreamnt
atgaaagactctaacaggtgttgctgtggccagttcaccaaccagcatatcccccctctg
ccaagtgcaacacccagcaaaaatgaagaggaaagcaaacaggtggagactcagcctgag
aaatggtctgttgccaagcacacccagagctacccaacagattcctatggagttcttgaa
ttccagggtggcggatattccaataaagccatgtatatccgtgtatcctatgacaccaag
ccagactcactgctccatctcatggtgaaagattggcagctggaactccccaagctctta
atatctgtgcatggaggcctccagaactttgagatgcagcccaagctgaaacaagtcttt
gggaaaggcctgatcaaggctgctatgaccaccggggcctggatcttcaccgggggtgtc
agcacaggtgttatcagccacgtaggggatgccttgaaagaccactcctccaagtccaga
ggccgggtttgtgctataggaattgctccatggggcatcgtggagaataaggaagacctg
gttggaaaggatgtaacaagagtgtaccagaccatgtccaaccctctaagtaagctctct
gtgctcaacaactcccacacccacttcatcctggctgacaatggcaccctgggcaagtat
ggcgccgaggtgaagctgcgaaggctgctggaaaagcacatctccctgcagaagatcaac
acaagactggggcagggcgtgcccctcgtgggtctcgtggtggaggggggccctaacgtg
gtgtccatcgtcttggaatacctgcaagaagagcctcccatccctgtggtgatttgtgat
ggcagcggacgtgcctcggacatcctgtcctttgcgcacaagtactgtgaagaaggcgga
ataataaatgagtccctcagggagcagcttctagttaccattcagaaaacatttaattat
aataaggcacaatcacatcagctgtttgcaattataatggagtgcatgaagaagaaagaa
ctcgtcactgtgttcagaatgggttctgagggccagcaggacatcgagatggcaatttta
actgccctgctgaaaggaacaaacgtatctgctccagatcagctgagcttggcactggct
tggaaccgcgtggacatagcacgaagccagatctttgtctttgggccccactggccgccc
ctgggaagcctggcacccccgacggacagcaaagccacggagaaggagaagaagccaccc
atggccaccaccaagggaggaagaggaaaagggaaaggcaagaagaaagggaaagtgaaa
gaggaagtggaggaagaaactgacccccggaagatagagctgctgaactgggtgaatgct
ttggagcaagcgatgctagatgctttagtcttagatcgtgtcgactttgtgaagctcctg
attgaaaacggagtgaacatgcaacactttctgaccattccgaggctggaggagctttat
aacacaagactgggtccaccaaacacacttcatctgctggtgagggatgtgaaaaagagc
aaccttccgcctgattaccacatcagcctcatagacatcgggctcgtgctggagtacctc
atgggaggagcctaccgctgcaactacactcggaaaaactttcggaccctttacaacaac
ttgtttggaccaaagaggcctaaagctcttaaacttctgggaatggaagatgatgagcct
ccagctaaagggaagaaaaagaaaaagaagaaaaaggaggaagagatcgacattgatgtg
gacgaccctgccgtgagtcggttccagtatcccttccacgagctgatggtgtgggcagtg
ctgatgaaacgccagaaaatggcagtgttcctctggcagcgaggggaagagagcatggcc
aaggccctggtggcctgcaagctctacaaggccatggcccacgagtcctccgagagtgat
ctggtggatgacatctcccaggacttggataacaattccaaagacttcggccagcttgct
ttggagttattagaccagtcctataagcatgacgagcagatcgctatgaaactcctgacc
tacgagctgaaaaactggagcaactcgacctgcctcaaactggccgtggcagccaaacac
cgggacttcattgctcacacctgcagccagatgctgctgaccgatatgtggatgggaaga
ctgcggatgcggaagaaccccggcctgaaggttatcatggggattcttctaccccccacc
atcttgtttttggaatttcgcacatatgatgatttctcgtatcaaacatccaaggaaaat
gaggatggcaaagaaaaagaagaggaaaatacggatgcaaatgcagatgctggctcaaga
aagggggatgaggagaacgagcacaaaaaacagagaagtattcccatcggaacaaagatc
tgtgaattctataacgcgcccattgtcaagttctggttttacacaatatcatacttgggc
tacctgctgctgtttaactacgtcatcctggtgcggatggatggctggccgtccctccag
gagtggatcgtcatctcctacatcgtgagcctggcgttagagaagatacgagagatcctc
atgtcagaaccaggcaaactcagccagaaaatcaaagtttggcttcaggagtactggaac
atcacagatctcgtggccatttccacattcatgattggagcaattcttcgcctacagaac
cagccctacatgggctatggccgggtgatctactgtgtggatatcatcttctggtacatc
cgtgtcctggacatctttggtgtcaacaagtatctggggccatacgtgatgatgattgga
aagatgatgatcgacatgctgtactttgtggtcatcatgctggtcgtgctcatgagtttc
ggagtagcccgtcaagccattctgcatccagaggagaagccctcttggaaactggcccga
aacatcttctacatgccctactggatgatctatggagaggtgtttgcagaccagatagac
ctctacgccatggaaattaatcctccttgtggtgagaacctatatgatgaggagggcaag
cggcttcctccctgtatccccggcgcctggctcactccagcactcatggcgtgctatcta
ctggtcgccaacatcctgctggtgaacctgctgattgctgtgttcaacaataccttcttt
gaagtaaaatcaatatccaaccaggtgtggaagttccagcgatatcagctgattatgaca
tttcatgacaggccagtcctgcccccaccgatgatcattttaagccacatctacatcatc
attatgcgtctcagcggccgctgcaggaaaaagagagaaggggaccaagaggaacgggat
cgtggattgaagctcttccttagcgacgaggagctaaagaggctgcatgagttcgaggag
cagtgcgtgcaggagcacttccgggagaaggaggatgagcagcagtcgtccagcgacgag
cgcatccgggtcacttctgaaagagttgaaaatatgtcaatgaggttggaagaaatcaat
gaaagagaaacttttatgaaaacttccctgcagactgttgaccttcgacttgctcagcta
gaagaattatctaacagaatggtgaatgctcttgaaaatcttgcgggaatcgacaggtct
gacctgatccaggcacggtcccgggcttcttctgaatgtgaggcaacgtatcttctccgg
caaagcagcatcaatagcgctgatggctacagcttgtatcgatatcattttaacggagaa
gagttattatttgaggatacatctctctccacgtcaccagggacaggagtcaggaaaaaa
acctgttccttccgtataaaggaagagaaggacgtgaaaacgcacctagtcccagaatgt
cagaacagtcttcacctttcactgggcacaagcacatcagcaaccccagatggcagtcac
cttgcagtagatgacttaaagaacgctgaagagtcaaaattaggtccagatattgggatt
tcaaaggaagatgatgaaagacagacagactctaaaaaagaagaaactatttccccaagt
ttaaataaaacagatgtgatacatggacaggacaaatcagatgttcaaaacactcagcta
acagtggaaacgacaaatatagaaggcactatttcctatcccctggaagaaaccaaaatt
acacgctatttccccgatgaaacgatcaatgcttgtaaaacaatgaagtccagaagcttc
gtctattcccggggaagaaagctggtcggtggggttaaccaggatgtagagtacagttca
atcacggaccagcaattgacgacggaatggcaatgccaagttcaaaagatcacgcgctct
catagcacagatattccttacattgtgtcggaagctgcagtgcaagctgagcataaagag
cagtttgcagatatgcaagatgaacaccatgtcgctgaagcaattcctcgaatccctcgc
ttgtccctaaccattactgacagaaatgggatggaaaacttactgtctgtgaagccagat
caaactttgggattcccatctctcaggtcaaaaagtttacatggacatcctaggaatgtg
aaatccattcagggaaagttagacagatctggacatgccagtagtgtaagcagcttagta
attgtgtctggaatgacagcagaagaaaaaaaggttaagaaagagaaagcttccacagaa
actgaatgctag

DBGET integrated database retrieval system