KEGG   Homo sapiens (human): 4311Help
Entry
4311              CDS       T01001                                 

Gene name
MME, CALLA, CD10, CMT2T, NEP, SCA43, SFE
Definition
(RefSeq) membrane metalloendopeptidase
  KO
K01389  neprilysin [EC:3.4.24.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04614  Renin-angiotensin system
hsa04640  Hematopoietic cell lineage
hsa04974  Protein digestion and absorption
hsa05010  Alzheimer disease
Disease
H00063  Spinocerebellar ataxia (SCA)
H00264  Charcot-Marie-Tooth disease
Drug target
Candoxatril: D01070
Candoxatrilat: D03349
Ecadotril: D03929
Omapatrilat: D01970
Racecadotril: D08464
Sacubitril: D10225
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    4311 (MME)
  09152 Endocrine system
   04614 Renin-angiotensin system
    4311 (MME)
  09154 Digestive system
   04974 Protein digestion and absorption
    4311 (MME)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    4311 (MME)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    4311 (MME)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    4311 (MME)
   04090 CD molecules [BR:hsa04090]
    4311 (MME)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.11  neprilysin
     4311 (MME)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M13: neprilysin family
   4311 (MME)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4311 (MME)
CD molecules [BR:hsa04090]
 Proteins
  4311 (MME)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M13_N Peptidase_M13
Motif
Other DBs
NCBI-GeneID: 4311
NCBI-ProteinID: NP_000893
OMIM: 120520
HGNC: 7154
Ensembl: ENSG00000196549
Vega: OTTHUMG00000158455
Pharos: P08473(Tclin)
UniProt: P08473
Structure
PDB: 

Position
3q25.2
AA seq 750 aa AA seqDB search
MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKD
VLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGA
SWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLY
NKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPEYLTKLKPILT
KYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERI
GYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAA
VVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGLGQAYR
AYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII
GTLQNSAEFSEAFHCRKNSYMNPEKKCRVW
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagtcagaaagtcagatggatataactgatatcaacactccaaagccaaagaag
aaacagcgatggactccactggagatcagcctctcggtccttgtcctgctcctcaccatc
atagctgtgacaatgatcgcactctatgcaacctacgatgatggtatttgcaagtcatca
gactgcataaaatcagctgctcgactgatccaaaacatggatgccaccactgagccttgt
acagactttttcaaatatgcttgcggaggctggttgaaacgtaatgtcattcccgagacc
agctcccgttacggcaactttgacattttaagagatgaactagaagtcgttttgaaagat
gtccttcaagaacccaaaactgaagatatagtagcagtgcagaaagcaaaagcattgtac
aggtcttgtataaatgaatctgctattgatagcagaggtggagaacctctactcaaactg
ttaccagacatatatgggtggccagtagcaacagaaaactgggagcaaaaatatggtgct
tcttggacagctgaaaaagctattgcacaactgaattctaaatatgggaaaaaagtcctt
attaatttgtttgttggcactgatgataagaattctgtgaatcatgtaattcatattgac
caacctcgacttggcctcccttctagagattactatgaatgcactggaatctataaagag
gcttgtacagcatatgtggattttatgatttctgtggccagattgattcgtcaggaagaa
agattgcccatcgatgaaaaccagcttgctttggaaatgaataaagttatggaattggaa
aaagaaattgccaatgctacggctaaacctgaagatcgaaatgatccaatgcttctgtat
aacaagatgacattggcccagatccaaaataacttttcactagagatcaatgggaagcca
ttcagctggttgaatttcacaaatgaaatcatgtcaactgtgaatattagtattacaaat
gaggaagatgtggttgtttatgctccagaatatttaaccaaacttaagcccattcttacc
aaatattctgccagagatcttcaaaatttaatgtcctggagattcataatggatcttgta
agcagcctcagccgaacctacaaggagtccagaaatgctttccgcaaggccctttatggt
acaacctcagaaacagcaacttggagacgttgtgcaaactatgtcaatgggaatatggaa
aatgctgtggggaggctttatgtggaagcagcatttgctggagagagtaaacatgtggtc
gaggatttgattgcacagatccgagaagtttttattcagactttagatgacctcacttgg
atggatgccgagacaaaaaagagagctgaagaaaaggccttagcaattaaagaaaggatc
ggctatcctgatgacattgtttcaaatgataacaaactgaataatgagtacctcgagttg
aactacaaagaagatgaatacttcgagaacataattcaaaatttgaaattcagccaaagt
aaacaactgaagaagctccgagaaaaggtggacaaagatgagtggataagtggagcagct
gtagtcaatgcattttactcttcaggaagaaatcagatagtcttcccagccggcattctg
cagccccccttctttagtgcccagcagtccaactcattgaactatgggggcatcggcatg
gtcataggacacgaaatcacccatggcttcgatgacaatggcagaaactttaacaaagat
ggagacctcgttgactggtggactcaacagtctgcaagtaactttaaggagcaatcccag
tgcatggtgtatcagtatggaaacttttcctgggacctggcaggtggacagcaccttaat
ggaattaatacactgggagaaaacattgctgataatggaggtcttggtcaagcatacaga
gcctatcagaattatattaaaaagaatggcgaagaaaaattacttcctggacttgaccta
aatcacaaacaactatttttcttgaactttgcacaggtgtggtgtggaacctataggcca
gagtatgcggttaactccattaaaacagatgtgcacagtccaggcaatttcaggattatt
gggactttgcagaactctgcagagttttcagaagcctttcactgccgcaagaattcatac
atgaatccagaaaagaagtgccgggtttggtga

DBGET integrated database retrieval system