KEGG   Homo sapiens (human): 4312Help
Entry
4312              CDS       T01001                                 

Gene name
MMP1, CLG, CLGN
Definition
(RefSeq) matrix metallopeptidase 1
  KO
K01388  matrix metalloproteinase-1 (interstitial collagenase) [EC:3.4.24.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04657  IL-17 signaling pathway
hsa04926  Relaxin signaling pathway
hsa05200  Pathways in cancer
hsa05219  Bladder cancer
hsa05323  Rheumatoid arthritis
Disease
H00028  Choriocarcinoma
H01714  Chronic obstructive pulmonary disease (COPD)
Drug target
Cipemastat: D03517
Marimastat: D03795
Rebimastat: D03800
Tanomastat: D03802
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    4312 (MMP1)
  09152 Endocrine system
   03320 PPAR signaling pathway
    4312 (MMP1)
   04926 Relaxin signaling pathway
    4312 (MMP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4312 (MMP1)
  09162 Cancer: specific types
   05219 Bladder cancer
    4312 (MMP1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    4312 (MMP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    4312 (MMP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.7  interstitial collagenase
     4312 (MMP1)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M10
   4312 (MMP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Reprolysin_3 Reprolysin_5 Reprolysin_4 Peptidase_M54 Peptidase_M66 DUF4953 FSAP_sig_propep
Motif
Other DBs
NCBI-GeneID: 4312
NCBI-ProteinID: NP_002412
OMIM: 120353
HGNC: 7155
Ensembl: ENSG00000196611
Vega: OTTHUMG00000048192
Pharos: P03956(Tclin)
UniProt: P03956 Q53G95
Structure
PDB: 

Position
11q22.2
AA seq 469 aa AA seqDB search
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPV
VEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIEN
YTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN
LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY
TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDR
FYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGY
PKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP
GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcacagctttcctccactgctgctgctgctgttctggggtgtggtgtctcacagcttc
ccagcgactctagaaacacaagagcaagatgtggacttagtccagaaatacctggaaaaa
tactacaacctgaagaatgatgggaggcaagttgaaaagcggagaaatagtggcccagtg
gttgaaaaattgaagcaaatgcaggaattctttgggctgaaagtgactgggaaaccagat
gctgaaaccctgaaggtgatgaagcagcccagatgtggagtgcctgatgtggctcagttt
gtcctcactgaggggaaccctcgctgggagcaaacacatctgacctacaggattgaaaat
tacacgccagatttgccaagagcagatgtggaccatgccattgagaaagccttccaactc
tggagtaatgtcacacctctgacattcaccaaggtctctgagggtcaagcagacatcatg
atatcttttgtcaggggagatcatcgggacaactctccttttgatggacctggaggaaat
cttgctcatgcttttcaaccaggcccaggtattggaggggatgctcattttgatgaagat
gaaaggtggaccaacaatttcagagagtacaacttacatcgtgttgcagctcatgaactc
ggccattctcttggactctcccattctactgatatcggggctttgatgtaccctagctac
accttcagtggtgatgttcagctagctcaggatgacattgatggcatccaagccatatat
ggacgttcccaaaatcctgtccagcccatcggcccacaaaccccaaaagcgtgtgacagt
aagctaacctttgatgctataactacgattcggggagaagtgatgttctttaaagacaga
ttctacatgcgcacaaatcccttctacccggaagttgagctcaatttcatttctgttttc
tggccacaactgccaaatgggcttgaagctgcttacgaatttgccgacagagatgaagtc
cggtttttcaaagggaataagtactgggctgttcagggacagaatgtgctacacggatac
cccaaggacatctacagctcctttggcttccctagaactgtgaagcatatcgatgctgct
ctttctgaggaaaacactggaaaaacctacttctttgttgctaacaaatactggaggtat
gatgaatataaacgatctatggatccaggttatcccaaaatgatagcacatgactttcct
ggaattggccacaaagttgatgcagttttcatgaaagatggatttttctatttctttcat
ggaacaagacaatacaaatttgatcctaaaacgaagagaattttgactctccagaaagct
aatagctggttcaactgcaggaaaaattga

KEGG   Homo sapiens (human): 4314Help
Entry
4314              CDS       T01001                                 

Gene name
MMP3, CHDS6, MMP-3, SL-1, STMY, STMY1, STR1
Definition
(RefSeq) matrix metallopeptidase 3
  KO
K01394  matrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05202  Transcriptional misregulation in cancer
hsa05215  Prostate cancer
hsa05323  Rheumatoid arthritis
Network
nt06240  Transcription
nt06272  Prostate cancer
  Element
N00128  TMPRSS2-ERG fusion to transcriptional activation
Disease
H01742  Coronary artery disease
Drug target
Marimastat: D03795
Prinomastat: D03797
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    4314 (MMP3)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    4314 (MMP3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    4314 (MMP3)
  09162 Cancer: specific types
   05215 Prostate cancer
    4314 (MMP3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    4314 (MMP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    4314 (MMP3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.17  stromelysin 1
     4314 (MMP3)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M10
   4314 (MMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin Reprolysin_4 DUF4953 Reprolysin_3 Reprolysin_5 Reprolysin_2
Motif
Other DBs
NCBI-GeneID: 4314
NCBI-ProteinID: NP_002413
OMIM: 185250
HGNC: 7173
Ensembl: ENSG00000149968
Vega: OTTHUMG00000048254
Pharos: P08254(Tchem)
UniProt: P08254
Structure
PDB: 

Position
11q22.2
AA seq 477 aa AA seqDB search
MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPV
VKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVN
YTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNV
LAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLY
HSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVS
TLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQF
WAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEP
GFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtcttccaatcctactgttgctgtgcgtggcagtttgctcagcctatccattg
gatggagctgcaaggggtgaggacaccagcatgaaccttgttcagaaatatctagaaaac
tactacgacctcaaaaaagatgtgaaacagtttgttaggagaaaggacagtggtcctgtt
gttaaaaaaatccgagaaatgcagaagttccttggattggaggtgacggggaagctggac
tccgacactctggaggtgatgcgcaagcccaggtgtggagttcctgatgttggtcacttc
agaacctttcctggcatcccgaagtggaggaaaacccaccttacatacaggattgtgaat
tatacaccagatttgccaaaagatgctgttgattctgctgttgagaaagctctgaaagtc
tgggaagaggtgactccactcacattctccaggctgtatgaaggagaggctgatataatg
atctcttttgcagttagagaacatggagacttttacccttttgatggacctggaaatgtt
ttggcccatgcctatgcccctgggccagggattaatggagatgcccactttgatgatgat
gaacaatggacaaaggatacaacagggaccaatttatttctcgttgctgctcatgaaatt
ggccactccctgggtctctttcactcagccaacactgaagctttgatgtacccactctat
cactcactcacagacctgactcggttccgcctgtctcaagatgatataaatggcattcag
tccctctatggacctccccctgactcccctgagacccccctggtacccacggaacctgtc
cctccagaacctgggacgccagccaactgtgatcctgctttgtcctttgatgctgtcagc
actctgaggggagaaatcctgatctttaaagacaggcacttttggcgcaaatccctcagg
aagcttgaacctgaattgcatttgatctcttcattttggccatctcttccttcaggcgtg
gatgccgcatatgaagttactagcaaggacctcgttttcatttttaaaggaaatcaattc
tgggctatcagaggaaatgaggtacgagctggatacccaagaggcatccacaccctaggt
ttccctccaaccgtgaggaaaatcgatgcagccatttctgataaggaaaagaacaaaaca
tatttctttgtagaggacaaatactggagatttgatgagaagagaaattccatggagcca
ggctttcccaagcaaatagctgaagactttccagggattgactcaaagattgatgctgtt
tttgaagaatttgggttcttttatttctttactggatcttcacagttggagtttgaccca
aatgcaaagaaagtgacacacactttgaagagtaacagctggcttaattgttga

DBGET integrated database retrieval system