KEGG   Homo sapiens (human): 4314Help
Entry
4314              CDS       T01001                                 

Gene name
MMP3, CHDS6, MMP-3, SL-1, STMY, STMY1, STR1
Definition
(RefSeq) matrix metallopeptidase 3
  KO
K01394  matrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05202  Transcriptional misregulation in cancer
hsa05215  Prostate cancer
hsa05323  Rheumatoid arthritis
Network
N00128  TMPRSS2-ERG fusion to transcriptional activation
Disease
H01742  Coronary artery disease
Drug target
Marimastat: D03795
Prinomastat: D03797
Tanomastat: D03802
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    4314 (MMP3)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    4314 (MMP3)
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    4314 (MMP3)
   05215 Prostate cancer
    4314 (MMP3)
  09162 Immune diseases
   05323 Rheumatoid arthritis
    4314 (MMP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    4314 (MMP3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.17  stromelysin 1
     4314 (MMP3)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M10
   4314 (MMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin Reprolysin_4 DUF4953 Reprolysin_3 Reprolysin_5 Reprolysin_2
Motif
Other DBs
NCBI-GeneID: 4314
NCBI-ProteinID: NP_002413
OMIM: 185250
HGNC: 7173
Ensembl: ENSG00000149968
Vega: OTTHUMG00000048254
Pharos: P08254(Tchem)
UniProt: P08254
Structure
PDB: 

Position
11q22.2
AA seq 477 aa AA seqDB search
MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPV
VKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVN
YTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNV
LAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLY
HSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVS
TLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQF
WAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEP
GFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtcttccaatcctactgttgctgtgcgtggcagtttgctcagcctatccattg
gatggagctgcaaggggtgaggacaccagcatgaaccttgttcagaaatatctagaaaac
tactacgacctcaaaaaagatgtgaaacagtttgttaggagaaaggacagtggtcctgtt
gttaaaaaaatccgagaaatgcagaagttccttggattggaggtgacggggaagctggac
tccgacactctggaggtgatgcgcaagcccaggtgtggagttcctgatgttggtcacttc
agaacctttcctggcatcccgaagtggaggaaaacccaccttacatacaggattgtgaat
tatacaccagatttgccaaaagatgctgttgattctgctgttgagaaagctctgaaagtc
tgggaagaggtgactccactcacattctccaggctgtatgaaggagaggctgatataatg
atctcttttgcagttagagaacatggagacttttacccttttgatggacctggaaatgtt
ttggcccatgcctatgcccctgggccagggattaatggagatgcccactttgatgatgat
gaacaatggacaaaggatacaacagggaccaatttatttctcgttgctgctcatgaaatt
ggccactccctgggtctctttcactcagccaacactgaagctttgatgtacccactctat
cactcactcacagacctgactcggttccgcctgtctcaagatgatataaatggcattcag
tccctctatggacctccccctgactcccctgagacccccctggtacccacggaacctgtc
cctccagaacctgggacgccagccaactgtgatcctgctttgtcctttgatgctgtcagc
actctgaggggagaaatcctgatctttaaagacaggcacttttggcgcaaatccctcagg
aagcttgaacctgaattgcatttgatctcttcattttggccatctcttccttcaggcgtg
gatgccgcatatgaagttactagcaaggacctcgttttcatttttaaaggaaatcaattc
tgggctatcagaggaaatgaggtacgagctggatacccaagaggcatccacaccctaggt
ttccctccaaccgtgaggaaaatcgatgcagccatttctgataaggaaaagaacaaaaca
tatttctttgtagaggacaaatactggagatttgatgagaagagaaattccatggagcca
ggctttcccaagcaaatagctgaagactttccagggattgactcaaagattgatgctgtt
tttgaagaatttgggttcttttatttctttactggatcttcacagttggagtttgaccca
aatgcaaagaaagtgacacacactttgaagagtaacagctggcttaattgttga

DBGET integrated database retrieval system