KEGG   Homo sapiens (human): 4321Help
Entry
4321              CDS       T01001                                 

Gene name
MMP12, HME, ME, MME, MMP-12
Definition
(RefSeq) matrix metallopeptidase 12
  KO
K01413  matrix metalloproteinase-12 (macrophage elastase) [EC:3.4.24.65]
Organism
hsa  Homo sapiens (human)
Drug target
Marimastat: D03795
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    4321 (MMP12)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.65  macrophage elastase
     4321 (MMP12)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M10
   4321 (MMP12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin Reprolysin_3 Metallopep Peptidase_M54 Peptidase_M66 Reprolysin_5 Reprolysin_4
Motif
Other DBs
NCBI-GeneID: 4321
NCBI-ProteinID: NP_002417
OMIM: 601046
HGNC: 7158
Ensembl: ENSG00000262406
Vega: OTTHUMG00000165848
Pharos: P39900(Tchem)
UniProt: P39900
Structure
PDB: 

Position
11q22.2
AA seq 470 aa AA seqDB search
MKFLLILLLQATASGALPLNSSTSLEKNNVLFGERYLEKFYGLEINKLPVTKMKYSGNLM
KEKIQEMQHFLGLKVTGQLDTSTLEMMHAPRCGVPDVHHFREMPGGPVWRKHYITYRINN
YTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGI
LAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTY
KYVDINTFRLSADDIRGIQSLYGDPKENQRLPNPDNSEPALCDPNLSFDAVTTVGNKIFF
FKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDDKYWLISNLRP
EPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWRYDERRQMMDPGYPKLITK
NFQGIGPKIDAVFYSKNKYYYFFQGSNQFEYDFLLQRITKTLKSNSWFGC
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttcttctaatactgctcctgcaggccactgcttctggagctcttcccctgaac
agctctacaagcctggaaaaaaataatgtgctatttggtgaaagatacttagaaaaattt
tatggccttgagataaacaaacttccagtgacaaaaatgaaatatagtggaaacttaatg
aaggaaaaaatccaagaaatgcagcacttcttgggtctgaaagtgaccgggcaactggac
acatctaccctggagatgatgcacgcacctcgatgtggagtccccgatgtccatcatttc
agggaaatgccaggggggcccgtatggaggaaacattatatcacctacagaatcaataat
tacacacctgacatgaaccgtgaggatgttgactacgcaatccggaaagctttccaagta
tggagtaatgttacccccttgaaattcagcaagattaacacaggcatggctgacattttg
gtggtttttgcccgtggagctcatggagacttccatgcttttgatggcaaaggtggaatc
ctagcccatgcttttggacctggatctggcattggaggggatgcacatttcgatgaggac
gaattctggactacacattcaggaggcacaaacttgttcctcactgctgttcacgagatt
ggccattccttaggtcttggccattctagtgatccaaaggccgtaatgttccccacctac
aaatatgttgacatcaacacatttcgcctctctgctgatgacatacgtggcattcagtcc
ctgtatggagacccaaaagagaaccaacgcttgccaaatcctgacaattcagaaccagct
ctctgtgaccccaatttgagttttgatgctgtcactaccgtgggaaataagatctttttc
ttcaaagacaggttcttctggctgaaggtttctgagagaccaaagaccagtgttaattta
atttcttccttatggccaaccttgccatctggcattgaagctgcttatgaaattgaagcc
agaaatcaagtttttctttttaaagatgacaaatactggttaattagcaatttaagacca
gagccaaattatcccaagagcatacattcttttggttttcctaactttgtgaaaaaaatt
gatgcagctgtttttaacccacgtttttataggacctacttctttgtagataaccagtat
tggaggtatgatgaaaggagacagatgatggaccctggttatcccaaactgattaccaag
aacttccaaggaatcgggcctaaaattgatgcagtcttctactctaaaaacaaatactac
tatttcttccaaggatctaaccaatttgaatatgacttcctactccaacgtatcaccaaa
acactgaaaagcaatagctggtttggttgttag

DBGET integrated database retrieval system