KEGG   Homo sapiens (human): 4322Help
Entry
4322              CDS       T01001                                 

Gene name
MMP13, CLG3, MANDP1, MDST, MMP-13
Definition
(RefSeq) matrix metallopeptidase 13
  KO
K07994  matrix metalloproteinase-13 (collagenase 3) [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04657  IL-17 signaling pathway
hsa04926  Relaxin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
Disease
H00479  Metaphyseal dysplasias
Drug target
Apratastat: D08859
Cipemastat: D03517
Prinomastat: D03797
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    4322 (MMP13)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    4322 (MMP13)
   04928 Parathyroid hormone synthesis, secretion and action
    4322 (MMP13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    4322 (MMP13)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     4322 (MMP13)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M10
   4322 (MMP13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Reprolysin_4 Reprolysin_3 DUF4953 Reprolysin_5
Motif
Other DBs
NCBI-GeneID: 4322
NCBI-ProteinID: NP_002418
OMIM: 600108
HGNC: 7159
Ensembl: ENSG00000137745
Vega: OTTHUMG00000165850
Pharos: P45452(Tclin)
UniProt: P45452 Q53H33
Structure
PDB: 

Position
11q22.2
AA seq 471 aa AA seqDB search
MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENA
ASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTY
RIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDG
PSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALM
FPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET
MIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGY
DILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLI
EEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcatccaggggtcctggctgccttcctcttcttgagctggactcattgtcgggccctg
ccccttcccagtggtggtgatgaagatgatttgtctgaggaagacctccagtttgcagag
cgctacctgagatcatactaccatcctacaaatctcgcgggaatcctgaaggagaatgca
gcaagctccatgactgagaggctccgagaaatgcagtctttcttcggcttagaggtgact
ggcaaacttgacgataacaccttagatgtcatgaaaaagccaagatgcggggttcctgat
gtgggtgaatacaatgttttccctcgaactcttaaatggtccaaaatgaatttaacctac
agaattgtgaattacacccctgatatgactcattctgaagtcgaaaaggcattcaaaaaa
gccttcaaagtttggtccgatgtaactcctctgaattttaccagacttcacgatggcatt
gctgacatcatgatctcttttggaattaaggagcatggcgacttctacccatttgatggg
ccctctggcctgctggctcatgcttttcctcctgggccaaattatggaggagatgcccat
tttgatgatgatgaaacctggacaagtagttccaaaggctacaacttgtttcttgttgct
gcgcatgagttcggccactccttaggtcttgaccactccaaggaccctggagcactcatg
tttcctatctacacctacaccggcaaaagccactttatgcttcctgatgacgatgtacaa
gggatccagtctctctatggtccaggagatgaagaccccaaccctaaacatccaaaaacg
ccagacaaatgtgacccttccttatcccttgatgccattaccagtctccgaggagaaaca
atgatctttaaagacagattcttctggcgcctgcatcctcagcaggttgatgcggagctg
tttttaacgaaatcattttggccagaacttcccaaccgtattgatgctgcatatgagcac
ccttctcatgacctcatcttcatcttcagaggtagaaaattttgggctcttaatggttat
gacattctggaaggttatcccaaaaaaatatctgaactgggtcttccaaaagaagttaag
aagataagtgcagctgttcactttgaggatacaggcaagactctcctgttctcaggaaac
caggtctggagatatgatgatactaaccatattatggataaagactatccgagactaata
gaagaagacttcccaggaattggtgataaagtagatgctgtctatgagaaaaatggttat
atctattttttcaacggacccatacagtttgaatacagcatctggagtaaccgtattgtt
cgcgtcatgccagcaaattccattttgtggtgttaa

DBGET integrated database retrieval system