KEGG   Homo sapiens (human): 4324Help
Entry
4324              CDS       T01001                                 

Gene name
MMP15, MMP-15, MT2-MMP, MT2MMP, MTMMP2, SMCP-2
Definition
(RefSeq) matrix metallopeptidase 15
  KO
K07995  matrix metalloproteinase-15 (membrane-inserted) [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    4324 (MMP15)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    4324 (MMP15)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     4324 (MMP15)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M10
   4324 (MMP15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin DUF3377 PG_binding_1 Peptidase_M54 Reprolysin_3 Astacin DUF4953 Peptidase_M66 Metallopep Orbi_VP6
Motif
Other DBs
NCBI-GeneID: 4324
NCBI-ProteinID: NP_002419
OMIM: 602261
HGNC: 7161
Ensembl: ENSG00000102996
Vega: OTTHUMG00000133466
Pharos: P51511(Tchem)
UniProt: P51511 A0A024R6U8
Position
16q21
AA seq 669 aa AA seqDB search
MGSDPSAPGRPGWTGSLLGDREEAARPRLLPLLLVLLGCLGLGVAAEDAEVHAENWLRLY
GYLPQPSRHMSTMRSAQILASALAEMQRFYGIPVTGVLDEETKEWMKRPRCGVPDQFGVR
VKANLRRRRKRYALTGRKWNNHHLTFSIQNYTEKLGWYHSMEAVRRAFRVWEQATPLVFQ
EVPYEDIRLRRQKEADIMVLFASGFHGDSSPFDGTGGFLAHAYFPGPGLGGDTHFDADEP
WTFSSTDLHGNNLFLVAVHELGHALGLEHSSNPNAIMAPFYQWKDVDNFKLPEDDLRGIQ
QLYGTPDGQPQPTQPLPTVTPRRPGRPDHRPPRPPQPPPPGGKPERPPKPGPPVQPRATE
RPDQYGPNICDGDFDTVAMLRGEMFVFKGRWFWRVRHNRVLDNYPMPIGHFWRGLPGDIS
AAYERQDGRFVFFKGDRYWLFREANLEPGYPQPLTSYGLGIPYDRIDTAIWWEPTGHTFF
FQEDRYWRFNEETQRGDPGYPKPISVWQGIPASPKGAFLSNDAAYTYFYKGTKYWKFDNE
RLRMEPGYPKSILRDFMGCQEHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDVGDGDGD
FGAGVNKDGGSRVVVQMEEVARTVNVVMVLVPLLLLLCVLGLTYALVQMQRKGAPRVLLY
CKRSLQEWV
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcgacccgagcgcgcccggacggccgggctggacgggcagcctcctcggcgac
cgggaggaggcggcgcggccgcgactgctgccgctgctcctggtgcttctgggctgcctg
ggccttggcgtagcggccgaagacgcggaggtccatgccgagaactggctgcggctttat
ggctacctgcctcagcccagccgccatatgtccaccatgcgttccgcccagatcttggcc
tcggcccttgcagagatgcagcgcttctacgggatcccagtcaccggtgtgctcgacgaa
gagaccaaggagtggatgaagcggccccgctgtggggtgccagaccagttcggggtacga
gtgaaagccaacctgcggcggcgtcggaagcgctacgccctcaccgggaggaagtggaac
aaccaccatctgacctttagcatccagaactacacggagaagttgggctggtaccactcg
atggaggcggtgcgcagggccttccgcgtgtgggagcaggccacgcccctggtcttccag
gaggtgccctatgaggacatccggctgcggcgacagaaggaggccgacatcatggtactc
tttgcctctggcttccacggcgacagctcgccgtttgatggcaccggtggctttctggcc
cacgcctatttccctggccccggcctaggcggggacacccattttgacgcagatgagccc
tggaccttctccagcactgacctgcatggaaacaacctcttcctggtggcagtgcatgag
ctgggccacgcgctggggctggagcactccagcaaccccaatgccatcatggcgccgttc
taccagtggaaggacgttgacaacttcaagctgcccgaggacgatctccgtggcatccag
cagctctacggtaccccagacggtcagccacagcctacccagcctctccccactgtgacg
ccacggcggccaggccggcctgaccaccggccgccccggcctccccagccaccaccccca
ggtgggaagccagagcggcccccaaagccgggccccccagtccagccccgagccacagag
cggcccgaccagtatggccccaacatctgcgacggggactttgacacagtggccatgctt
cgcggggagatgttcgtgttcaagggccgctggttctggcgagtccggcacaaccgcgtc
ctggacaactatcccatgcccatcgggcacttctggcgtggtctgcccggtgacatcagt
gctgcctacgagcgccaagacggtcgttttgtctttttcaaaggtgaccgctactggctc
tttcgagaagcgaacctggagcccggctacccacagccgctgaccagctatggcctgggc
atcccctatgaccgcattgacacggccatctggtgggagcccacaggccacaccttcttc
ttccaagaggacaggtactggcgcttcaacgaggagacacagcgtggagaccctgggtac
cccaagcccatcagtgtctggcaggggatccctgcctcccctaaaggggccttcctgagc
aatgacgcagcctacacctacttctacaagggcaccaaatactggaaattcgacaatgag
cgcctgcggatggagcccggctaccccaagtccatcctgcgggacttcatgggctgccag
gagcacgtggagccaggcccccgatggcccgacgtggcccggccgcccttcaacccccac
gggggtgcagagcccggggcggacagcgcagagggcgacgtgggggatggggatggggac
tttggggccggggtcaacaaggacgggggcagccgcgtggtggtgcagatggaggaggtg
gcacggacggtgaacgtggtgatggtgctggtgccactgctgctgctgctctgcgtcctg
ggcctcacctacgcgctggtgcagatgcagcgcaagggtgcgccacgtgtcctgctttac
tgcaagcgctcgctgcaggagtgggtctga

DBGET integrated database retrieval system