KEGG   Homo sapiens (human): 4330Help
Entry
4330              CDS       T01001                                 

Gene name
MN1, MGCR, MGCR1, MGCR1-PEN, dJ353E16.2
Definition
(RefSeq) MN1 proto-oncogene, transcriptional regulator
  KO
K22543  transcriptional activator MN1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4330 (MN1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Other transcription factors
   Others
    4330 (MN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EPL1
Motif
Other DBs
NCBI-GeneID: 4330
NCBI-ProteinID: NP_002421
OMIM: 156100
HGNC: 7180
Ensembl: ENSG00000169184
Vega: OTTHUMG00000150975
Pharos: Q10571(Tbio)
UniProt: Q10571 A0A024R1C3
Position
22q12.1
AA seq 1320 aa AA seqDB search
MFGLDQFEPQVNSRNAGQGERNFNETGLSMNTHFKAPAFHTGGPPGPVDPAMSALGEPPI
LGMNMEPYGFHARGHSELHAGGLQAQPVHGFFGGQQPHHGHPGSHHPHQHHPHFGGNFGG
PDPGASCLHGGRLLGYGGAAGGLGSQPPFAEGYEHMAESQGPESFGPQRPGNLPDFHSSG
ASSHAVPAPCLPLDQSPNRAASFHGLPSSSGSDSHSLEPRRVTNQGAVDSLEYNYPGEAP
SGHFDMFSPSDSEGQLPHYAAGRQVPGGAFPGASAMPRAAGMVGLSKMHAQPPQQQPQQQ
QQPQQQQQQHGVFFERFSGARKMPVGLEPSVGSRHPLMQPPQQAPPPPQQQPPQQPPQQQ
PPPPPGLLVRQNSCPPALPRPQQGEAGTPSGGLQDGGPMLPSQHAQFEYPIHRLENRSMH
PYSEPVFSMQHPPPQQAPNQRLQHFDAPPYMNVAKRPRFDFPGSAGVDRCASWNGSMHNG
ALDNHLSPSAYPGLPGEFTPPVPDSFPSGPPLQHPAPDHQSLQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQRQNAALMIKQMASRNQQQRLRQPNLAQLGHPGDVGQGGLVHGGPVGGLAQ
PNFEREGGSTGAGRLGTFEQQAPHLAQESAWFSGPHPPPGDLLPRRMGGSGLPADCGPHD
PSLAPPPPPGGSGVLFRGPLQEPMRMPGEGHVPALPSPGLQFGGSLGGLGQLQSPGAGVG
LPSAASERRPPPPDFATSALGGQPGFPFGAAGRQSTPHSGPGVNSPPSAGGGGGSSGGGG
GGGAYPPQPDFQPSQRTSASKLGALSLGSFNKPSSKDNLFGQSCLAALSTACQNMIASLG
APNLNVTFNKKNPPEGKRKLSQNETDGAAVAGNPGSDYFPGGTAPGAPGPGGPSGTSSSG
SKASGPPNPPAQGDGTSLSPNYTLESTSGNDGKPVSGGGGRGRGRRKRDSGHVSPGTFFD
KYSAAPDSGGAPGVSPGQQQASGAAVGGSSAGETRGAPTPHEKALTSPSWGKGAELLLGD
QPDLIGSLDGGAKSDSSSPNVGEFASDEVSTSYANEDEVSSSSDNPQALVKASRSPLVTG
SPKLPPRGVGAGEHGPKAPPPALGLGIMSNSTSTPDSYGGGGGPGHPGTPGLEQVRTPTS
SSGAPPPDEIHPLEILQAQIQLQRQQFSISEDQPLGLKGGKKGECAVGASGAQNGDSELG
SCCSEAVKSAMSTIDLDSLMAEHSAAWYMPADKALVDSADDDKTLAPWEKAKPQNPNSKE
AHDLPANKASASQPGSHLQCLSVHCTDDVGDAKARASVPTWRSLHSDISNRFGTFVAALT
NT seq 3963 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggctggaccaattcgagccccaggtcaacagcaggaacgctggccagggcgag
aggaactttaacgagaccggactgagcatgaacacccactttaaggccccggctttccac
actggggggccccctggccctgtggatcctgctatgagcgcgctgggcgaacccccgatc
ttgggcatgaacatggagccctacggcttccacgcgcgcggccactcggagttgcacgca
ggggggctgcaagcgcagcctgtgcacggcttctttggcggccagcagcctcaccacggc
cacccgggaagtcatcatccccaccagcatcacccccactttgggggcaacttcggtggc
ccggaccccggggcctcgtgcctgcacgggggtcgcctgctcggctacggcggcgcagcc
ggaggcctgggcagccagccgcccttcgccgagggctatgagcacatggcggagagccag
gggcctgagagcttcggcccgcagcgaccggggaacctcccggacttccacagttcaggt
gcctccagccacgccgtgccggccccatgcctgccgctggaccagagccctaaccgagcc
gcctccttccacggcctgccgtcctccagcggctccgattcccacagtctggagccacgg
agggtgacgaaccaaggagccgtcgactcgctggaatacaattacccgggcgaggcgccc
tcgggacattttgacatgttttcgccctctgactccgaagggcagctgcctcattatgca
gcgggtcgccaggttcctgggggcgctttcccgggcgcctcggccatgcccagagctgcg
ggcatggtgggcttgtccaaaatgcacgcccagccaccgcagcagcagccccagcagcag
cagcagccccagcagcagcagcagcagcatggtgtgttctttgagaggttcagtggggcc
agaaagatgcctgtgggtctggagccctcagtgggctccaggcacccgttaatgcagcct
ccccagcaggccccgccaccccctcagcagcagcccccgcagcagccgccacagcagcag
ccgccgccgccacccgggcttctagtccgacaaaattcgtgcccgcctgcgctccctcgg
ccccagcagggcgaggcgggcacgcccagcggcggcctgcaggacggaggccccatgctg
cccagccagcacgcgcaattcgagtatcccatccaccggctggagaaccggagcatgcac
ccttattccgagcctgttttcagcatgcagcatcctcctccgcagcaggcgcccaaccag
cggctgcagcatttcgacgcgcccccctacatgaacgtggccaagaggccgcgcttcgac
tttccgggcagcgcgggagtggaccgctgcgcttcgtggaacggcagcatgcacaacggc
gctctggataatcacctctccccttccgcctacccaggcctacccggcgagttcacaccg
cctgtgcccgacagcttcccttcggggccgcccctgcagcatccggccccggaccaccag
tccctgcaacagcagcagcagcagcagcagcagcagcaacagcagcagcagcagcagcaa
cagcaacagcaacagcagcagcagcagcagcgccaaaacgcggccctcatgattaagcag
atggcgtcgcggaatcagcagcagcggctgcgccagcccaacctggctcagctaggccac
cccggggacgtgggccagggcggcctggtgcatggcggcccggtgggcggcttggcccag
ccgaactttgagcgcgaaggcggcagcacgggcgccgggcgtctgggcaccttcgagcag
caggcgccgcacttggcgcaagagagcgcgtggttctcaggtccgcatccgccgcccgga
gacctgctgccccgtaggatgggcggctcgggtctgcccgctgactgtggcccgcacgac
cccagcctggcgccccctcctccgcctggtggctcgggggtgctgttccggggccctctg
caggagccgatgaggatgcccggagagggccacgtgcccgcgctgccttcaccgggcctg
cagttcgggggcagtctgggaggcctgggtcagctgcagtcgcccggggcgggcgtgggg
ctccccagcgctgcttcggagcgccggcccccgccgccggactttgctacgtctgcgctc
gggggccagccgggctttccgtttggtgcagccggccggcagtccacgccgcacagcggt
ccaggcgtgaactcgccccccagcgcgggagggggcggtggcagctctggtggcggcggt
ggcgggggtgcctacccgccgcagcctgatttccagcccagccagcgcacctcggccagt
aaattgggcgcgctctcgctgggctccttcaacaagcccagctccaaggacaacctgttc
ggccagagctgcctggctgcgctctccaccgcttgccagaacatgatcgccagcctcggg
gcccccaacctcaacgtgaccttcaacaagaagaacccgccagagggcaagaggaaactg
agccagaacgagaccgacggcgcggcagtggccggcaacccgggctcggattacttccca
ggagggactgctcctggggccccaggacccggaggcccgtccgggaccagtagcagcggc
tccaaagcctcggggccgcccaaccctccagcccagggggacggcaccagcctctccccc
aactacaccctggaatccacgtcggggaatgacggcaagccggtctccgggggcggcggc
cggggacggggtcgcagaaaaagggacagtggtcacgtgagccctggcaccttctttgac
aagtactcggcggctccggacagcgggggcgcacctggggtgagcccagggcagcagcaa
gcgtcaggcgcagccgtcgggggaagctccgcaggcgagacgcgcggggcaccgacgccc
cacgaaaaggcgctcacgtcgccatcctgggggaagggggctgagttgctcctgggggat
cagccggacctcattgggtccctggacggcggggccaagtcggacagtagttcgccaaac
gtgggtgagttcgcctcggacgaggtgagcacgagctacgccaatgaggacgaggtgtcg
tccagctctgacaacccccaggcactagttaaagcgagcaggagtcccctggtgaccggc
tcgcccaaactccctccccgtggggtaggcgccggggaacacggaccgaaggcgcccccg
cccgccctcggcctgggcatcatgtctaactctacctcgacccctgacagctacggcggc
ggtgggggcccgggccatccgggcactccgggcctggagcaggtccgcaccccgacgagc
agcagcggcgccccgccacccgacgagatccaccccctggagatccttcaggcgcagatc
cagctacagaggcagcagttcagcatctccgaggaccagcctctggggctgaagggtggc
aagaagggtgagtgcgccgtcggggcctcaggggcgcagaatggcgacagcgagctgggc
agctgctgctccgaggcggtcaagagcgccatgagcaccattgacctggactcgctgatg
gcagagcacagcgctgcctggtacatgcccgctgacaaggccctggtggacagcgcggac
gacgacaagacgttggcgccctgggagaaggccaaaccccagaaccccaacagcaaagaa
gcccacgacctccctgcaaacaaggcctcagcatcccagcctggcagccacttgcagtgc
ctgtctgtccactgcacagacgacgtgggtgacgccaaggctcgagcctccgtgcccacc
tggcggtccctgcattctgacatctccaacagatttgggacattcgtggctgccctaact
tga

DBGET integrated database retrieval system