KEGG   Homo sapiens (human): 4331
Entry
4331              CDS       T01001                                 
Symbol
MNAT1, CAP35, MAT1, RNF66, TFB3
Name
(RefSeq) MNAT1 component of CDK activating kinase
  KO
K10842  CDK-activating kinase assembly factor MAT1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa03420  Nucleotide excision repair
Network
nt06502  Nucleotide excision repair
  Element
N01425  Global genome NER
N01430  Transcription-coupled NER
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4331 (MNAT1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    4331 (MNAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    4331 (MNAT1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    4331 (MNAT1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     4331 (MNAT1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     4331 (MNAT1)
SSDB
Motif
Pfam: MAT1 zf-C3HC4_5 zf-RING_5 zf-RING_UBOX zf-C3HC4 DZR_2 zf-RING_2 zf-C3HC4_2 zf-UDP Prok-RING_4 zinc-ribbons_6 LMBR1 zf-RING_4 zf-P11 DNA_ligase_ZBD Poty_PP DUF1272
Other DBs
NCBI-GeneID: 4331
NCBI-ProteinID: NP_002422
OMIM: 602659
HGNC: 7181
Ensembl: ENSG00000020426
Pharos: P51948(Tbio)
UniProt: P51948 A0A024R688
Structure
Position
14:60734761..60969965
AA seq 309 aa
MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRV
QLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLDNTKK
KMEIYQKENKDVIQKNKLKLTREQEELEEALEVERQENEQRRLFIQKEEQLQQILKRKNK
QAFLDELESSDLPVALLLAQHKDRSTQLEMQLEKPKPVKPVTFSTGIKMGQHISLAPIHK
LEEALYEYQPLQIETYGPHVPELEMLGRLGYLNHVRAASPQDLAGGYTSSLACHRALQDA
FSGLFWQPS
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgatcagggttgccctcggtgtaagaccaccaaatatcggaacccctccttgaag
ctgatggtgaatgtgtgcggacacactctctgtgaaagttgtgtagatttactgtttgtg
agaggagctggaaactgccctgagtgtggtactccactcagaaagagcaacttcagggta
caactctttgaagatcccactgttgacaaggaggttgagatcaggaaaaaagtgctaaag
atatacaataaaagggaagaagattttcctagtctaagagaatacaatgatttcttggaa
gaagtggaagaaattgttttcaacttgaccaacaatgtggatttggacaacaccaaaaag
aaaatggagatataccaaaaggaaaacaaagatgttattcagaaaaataaattaaagctg
actcgagaacaggaagaactggaagaagctttagaagtggaacgacaggaaaatgaacaa
agaagattatttatacaaaaagaagaacaactgcagcagattctaaaaaggaagaataag
caggcttttttagatgagctggagagttctgatctccctgttgctctgcttttggctcag
cataaagatagatctacccaattagaaatgcaacttgagaaacccaaacctgtaaaacca
gtgacgttttccacaggcatcaaaatgggtcaacatatttcactggcacctattcacaag
cttgaagaagctctgtatgaataccagccactgcagatagagacatatggaccacatgtt
cctgagcttgagatgctaggaagacttgggtatttaaaccatgtcagagctgcctcacca
caggaccttgctggaggctatacttcttctcttgcttgtcacagagcactacaggatgca
ttcagtgggcttttctggcagcccagttaa

DBGET integrated database retrieval system