KEGG   Homo sapiens (human): 4342Help
Entry
4342              CDS       T01001                                 

Gene name
MOS, MSV
Definition
(RefSeq) MOS proto-oncogene, serine/threonine kinase
  KO
K04367  proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04810  Regulation of actin cytoskeleton
hsa04914  Progesterone-mediated oocyte maturation
Module
hsa_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    4342 (MOS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    4342 (MOS)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    4342 (MOS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4342 (MOS)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4342 (MOS)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  MOS family
   4342 (MOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 4342
NCBI-ProteinID: NP_005363
OMIM: 190060
HGNC: 7199
Ensembl: ENSG00000172680
Vega: OTTHUMG00000164299
Pharos: P00540(Tbio)
UniProt: P00540
Position
8q12.1
AA seq 346 aa AA seqDB search
MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATLPRAPRLPRRLAWCSIDWEQV
CLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRV
VAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLK
YSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKISDFGCSEKLEDLLCFQTPSYPLG
GTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLS
AAVFEDSLPGQRLGDVIQRCWRPSAAQRPSARLLLVDLTSLKAELG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgcccctggccctacgcccctacctccggagcgagttttccccatcggtggac
gcgcggccctgcagcagtccctcagagctacctgcgaagctgcttctgggggccactctt
cctcgggccccgcggctgccgcgccggctggcctggtgctccattgactgggagcaggtg
tgcttgctgcagaggctgggagctggagggtttggctcggtgtacaaggcgacttaccgc
ggtgttcctgtggccataaagcaagtgaacaagtgcaccaagaaccgactagcatctcgg
cggagtttctgggctgagctcaacgtagcaaggctgcgccacgataacatcgtgcgcgtg
gtggctgccagcacgcgcacgcccgcagggtccaatagcctagggaccatcatcatggag
ttcggtggcaacgtcactttacaccaagtcatctatggcgccgccggccaccctgagggg
gacgcaggggagcctcactgccgcactggaggacagttaagtttgggaaagtgtctcaag
tactcactagatgttgtgaacggcctgctcttcctccactcgcaaagcattgtgcacttg
gacctgaagcccgcgaacatcttgatcagtgagcaggatgtctgtaaaattagtgacttc
ggttgctctgagaagttggaagatctgctgtgcttccagacaccctcttaccctctagga
ggcacatacacccaccgcgccccggagctcctgaaaggagagggcgtgacgcctaaagcc
gacatttattcctttgccatcactctctggcaaatgactaccaagcaggcgccgtattcg
ggggagcggcagcacatactgtacgcggtggtggcctacgacctgcgcccgtccctctcc
gctgccgtcttcgaggactcgctccccgggcagcgccttggggacgtcatccagcgctgc
tggagacccagcgcggcgcagaggccgagcgcgcggctgcttttggtggatctcacctct
ttgaaagctgaactcggctga

DBGET integrated database retrieval system