KEGG   Homo sapiens (human): 4345
Entry
4345              CDS       T01001                                 
Symbol
CD200, MOX1, MOX2, MRC, OX-2
Name
(RefSeq) CD200 molecule
  KO
K06556  CD200 antigen
Organism
hsa  Homo sapiens (human)
Drug target
Samalizumab: D09961
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    4345 (CD200)
CD molecules [BR:hsa04090]
 Proteins
  4345 (CD200)
SSDB
Motif
Pfam: ig Ig_3 V-set I-set C2-set_2 Ig_2 TMEM128
Other DBs
NCBI-GeneID: 4345
NCBI-ProteinID: NP_005935
OMIM: 155970
HGNC: 7203
Ensembl: ENSG00000091972
Pharos: P41217(Tbio)
UniProt: P41217
Position
3:112332573..112362812
AA seq 269 aa
MERLVIRMPFSHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYTPASLKCSLQNAQEAL
IVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYM
CLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIE
NSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKGYWFSVPLL
LSIVSLVILLVLISILLYWKRHRNQDREP
NT seq 810 nt   +upstreamnt  +downstreamnt
atggagaggctggtgatcaggatgcccttctctcatctgtctacctacagcctggtttgg
gtcatggcagcagtggtgctgtgcacagcacaagtgcaagtggtgacccaggatgaaaga
gagcagctgtacacacctgcttccttaaaatgctctctgcaaaatgcccaggaagccctc
attgtgacatggcagaaaaagaaagctgtaagcccagaaaacatggtcaccttcagcgag
aaccatggggtggtgatccagcctgcctataaggacaagataaacattacccagctggga
ctccaaaactcaaccatcaccttctggaatatcaccctggaggatgaagggtgttacatg
tgtctcttcaatacctttggttttgggaagatctcaggaacggcctgcctcaccgtctat
gtacagcccatagtatcccttcactacaaattctctgaagaccacctaaatatcacttgc
tctgccactgcccgcccagcccccatggtcttctggaaggtccctcggtcagggattgaa
aatagtacagtgactctgtctcacccaaatgggaccacgtctgttaccagcatcctccat
atcaaagaccctaagaatcaggtggggaaggaggtgatctgccaggtgctgcacctgggg
actgtgaccgactttaagcaaaccgtcaacaaaggctattggttttcagttccgctattg
ctaagcattgtttccctggtaattcttctcgtcctaatctcaatcttactgtactggaaa
cgtcaccggaatcaggaccgagagccctaa

DBGET integrated database retrieval system