KEGG   Homo sapiens (human): 435
Entry
435               CDS       T01001                                 

Gene name
ASL, ASAL
Definition
(RefSeq) argininosuccinate lyase
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00220  Arginine biosynthesis
hsa00250  Alanine, aspartate and glutamate metabolism
hsa01100  Metabolic pathways
hsa01230  Biosynthesis of amino acids
Module
hsa_M00029  Urea cycle
hsa_M00844  Arginine biosynthesis, ornithine => arginine
Network
nt06010  Urea cycle
  Element
N00593  Urea cycle
N00594  ARG1 deficiency in urea cycle
N00595  ASL deficiency in urea cycle
Disease
H01028  Argininosuccinic aciduria
H01398  Primary hyperammonemic disorders (Urea cycle disorders)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    435 (ASL)
   00220 Arginine biosynthesis
    435 (ASL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    435 (ASL)
Enzymes [BR:hsa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     435 (ASL)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   435 (ASL)
SSDB
Motif
Pfam: Lyase_1 ASL_C2 T4SS_CagC
Other DBs
NCBI-GeneID: 435
NCBI-ProteinID: NP_000039
OMIM: 608310
HGNC: 746
Ensembl: ENSG00000126522
Vega: OTTHUMG00000022876
Pharos: P04424(Tbio)
UniProt: P04424 A0A024RDL8
Structure
PDB: 
1K62 1AOS

Position
7q11.21
AA seq 464 aa
MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEM
DQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTD
LRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVAL
TRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVA
EFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKA
GRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENM
GQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLF
SGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggcctcggagagtgggaagctttggggtggccggtttgtgggtgcagtggaccccatc
atggagaagttcaacgcgtccattgcctacgaccggcacctttgggaggtggatgttcaa
ggcagcaaagcctacagcaggggcctggagaaggcagggctcctcaccaaggccgagatg
gaccagatactccatggcctagacaaggtggctgaggagtgggcccagggcaccttcaaa
ctgaactccaatgatgaggacatccacacagccaatgagcgccgcctgaaggagctcatt
ggtgcaacggcagggaagctgcacacgggacggagccggaatgaccaggtggtcacagac
ctcaggctgtggatgcggcagacctgctccacgctctcgggcctcctctgggagctcatt
aggaccatggtggatcgggcagaggcggaacgtgatgttctcttcccggggtacacccat
ttgcagagggcccagcccatccgctggagccactggattctgagccacgccgtggcactg
acccgagactctgagcggctgctggaggtgcggaagcggatcaatgtcctgcccctgggg
agtggggccattgcaggcaatcccctgggtgtggaccgagagctgctccgagcagaactc
aactttggggccatcactctcaacagcatggatgccactagtgagcgggactttgtggcc
gagttcctgttctgggcttcgctgtgcatgacccatctcagcaggatggccgaggacctc
atcctctactgcaccaaggaattcagcttcgtgcagctctcagatgcctacagcacggga
agcagcctgatgccccagaagaaaaaccccgacagtttggagctgatccggagcaaggct
gggcgtgtgtttgggcggtgtgccgggctcctgatgaccctcaagggacttcccagcacc
tacaacaaagacttacaggaggacaaggaagctgtgtttgaagtgtcagacactatgagt
gccgtgctccaggtggccactggcgtcatctctacgctgcagattcaccaagagaacatg
ggacaggctctcagccccgacatgctggccactgaccttgcctattacctggtccgcaaa
gggatgccattccgccaggcccacgaggcctccgggaaagctgtgttcatggccgagacc
aagggggtcgccctcaaccagctgtcactgcaggagctgcagaccatcagccccctgttc
tcgggcgacgtgatctgcgtgtgggactacgggcacagtgtggagcagtatggtgccctg
ggcggcactgcgcgctccagcgtcgactggcagatccgccaggtgcgggcgctactgcag
gcacagcaggcctag

DBGET integrated database retrieval system