KEGG   Homo sapiens (human): 4353Help
Entry
4353              CDS       T01001                                 

Gene name
MPO
Definition
(RefSeq) myeloperoxidase
  KO
K10789  myeloperoxidase [EC:1.11.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00983  Drug metabolism - other enzymes
hsa04145  Phagosome
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
N00116  Mutation-inactivated RUNX1 to transcription
N00118  TEL-AML1 fusion to transcriptional repression
Disease
H00101  Other phagocyte defects
H02025  Myeloperoxidase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    4353 (MPO)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4353 (MPO)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    4353 (MPO)
  09162 Cancers: Specific types
   05221 Acute myeloid leukemia
    4353 (MPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    4353 (MPO)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.2  myeloperoxidase
     4353 (MPO)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4353 (MPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 4353
NCBI-ProteinID: NP_000241
OMIM: 606989
HGNC: 7218
Ensembl: ENSG00000005381
Vega: OTTHUMG00000178922
Pharos: P05164(Tchem)
UniProt: P05164
Structure
PDB: 

Position
17q22
AA seq 745 aa AA seqDB search
MGVPFFSSLRCMVDLGPCWAGGLTAEMKLLLALAGLLAILATPQPSEGAAPAVLGEVDTS
LVLSSMEEAKQLVDKAYKERRESIKQRLRSGSASPMELLSYFKQPVAATRTAVRAADYLH
VALDLLERKLRSLWRRPFNVTDVLTPAQLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMC
NNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTD
QLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVNCETSCVQQPPCFPLKIPPND
PRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQL
GLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLL
REHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYR
SYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLE
GGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYN
AWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPL
LACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMS
NSYPRDFVNCSTLPALNLASWREAS
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgggggttcccttcttctcttctctcagatgcatggtggacttaggaccttgctgggct
gggggtctcactgcagagatgaagctgcttctggccctagcagggctcctggccattctg
gccacgccccagccctctgaaggtgctgctccagctgtcctgggggaggtggacacctcg
ttggtgctgagctccatggaggaggccaagcagctggtggacaaggcctacaaggagcgg
cgggaaagcatcaagcagcggcttcgcagcggctcagccagccccatggaactcctatcc
tacttcaagcagccggtggcagccaccaggacggcggtgagggccgctgactacctgcac
gtggctctagacctgctggagaggaagctgcggtccctgtggcgaaggccattcaatgtc
actgatgtgctgacgcccgcccagctgaatgtgttgtccaagtcaagcggctgcgcctac
caggacgtgggggtgacttgcccggagcaggacaaataccgcaccatcaccgggatgtgc
aacaacagacgcagccccacgctgggggcctccaaccgtgcctttgtgcgctggctgccg
gcggagtatgaggacggcttctctcttccctacggctggacgcccggggtcaagcgcaac
ggcttcccggtggctctggctcgcgcggtctccaacgagatcgtgcgcttccccactgat
cagctgactccggaccaggagcgctcactcatgttcatgcaatggggccagctgttggac
cacgacctcgacttcacccctgagccggccgcccgggcctccttcgtcactggcgtcaac
tgcgagaccagctgcgttcagcagccgccctgcttcccgctcaagatcccgcccaatgac
ccccgcatcaagaaccaagccgactgcatcccgttcttccgctcctgcccggcttgcccc
gggagcaacatcaccatccgcaaccagatcaacgcgctcacttccttcgtggacgccagc
atggtgtacggcagcgaggagcccctggccaggaacctgcgcaacatgtccaaccagctg
gggctgctggccgtcaaccagcgcttccaagacaacggccgggccctgctgccctttgac
aacctgcacgatgacccctgtctcctcaccaaccgctcagcgcgcatcccctgcttcctg
gcaggggacacccgttccagtgagatgcccgagctcacctccatgcacaccctcttactt
cgggagcacaaccggctggccacagagctcaagagcctgaaccctaggtgggatggggag
aggctctaccaggaagcccggaagatcgtgggggccatggtccagatcatcacttaccgg
gactacctgcccctggtgctggggccaacggccatgaggaagtacctgcccacgtaccgt
tcctacaatgactcagtggacccacgcatcgccaacgtcttcaccaatgccttccgctac
ggccacaccctcatccaacccttcatgttccgcctggacaatcggtaccagcccatggaa
cccaacccccgtgtccccctcagcagggtcttttttgcctcctggagggtcgtgctggaa
ggtggcattgaccccatcctccggggcctcatggccacccctgccaagctgaatcgtcag
aaccaaattgcagtggatgagatccgggagcgattgtttgagcaggtcatgaggattggg
ctggacctgcctgctctgaacatgcagcgcagcagggaccacggcctcccaggatacaat
gcctggaggcgcttctgtgggctcccgcagcctgaaactgtgggccagctgggcacggtg
ctgaggaacctgaaattggcgaggaaactgatggagcagtatggcacgcccaacaacatc
gacatctggatgggcggcgtgtccgagcctctgaagcgcaaaggccgcgtgggcccactc
ctcgcctgcatcatcggtacccagttcaggaagctccgggatggtgatcggttttggtgg
gagaacgagggtgtgttcagcatgcagcagcgacaggccctggcccagatctcattgccc
cggatcatctgcgacaacacaggcatcaccaccgtgtctaagaacaacatcttcatgtcc
aactcatatccccgggactttgtcaactgcagtacacttcctgcattgaacctggcttcc
tggagggaagcctcctag

DBGET integrated database retrieval system