KEGG   Homo sapiens (human): 4357Help
Entry
4357              CDS       T01001                                 

Gene name
MPST, MST, TST2, TUM1
Definition
(RefSeq) mercaptopyruvate sulfurtransferase
  KO
K01011  thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00270  Cysteine and methionine metabolism
hsa00920  Sulfur metabolism
hsa01100  Metabolic pathways
hsa04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    4357 (MPST)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4357 (MPST)
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    4357 (MPST)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.1  thiosulfate sulfurtransferase
     4357 (MPST)
    2.8.1.2  3-mercaptopyruvate sulfurtransferase
     4357 (MPST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rhodanese B12D
Motif
Other DBs
NCBI-GeneID: 4357
NCBI-ProteinID: NP_001013454
OMIM: 602496
HGNC: 7223
Ensembl: ENSG00000128309
Vega: OTTHUMG00000150543
Pharos: P25325(Tbio)
UniProt: P25325 A0A140VJX3
Structure
PDB: 

Position
22q12.3
AA seq 297 aa AA seqDB search
MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFF
DIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAF
GHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQV
VDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDL
SKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRARPEDVISEGRGKTH
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgccgcagctctgccgcgcgctggtgtcggcgcaatgggtggcggaggcgctg
cgggccccgcgcgctgggcagcctctgcagctgctggacgcctcctggtacctgccgaag
ctggggcgcgacgcgcgacgcgagttcgaggagcgccacatcccgggcgccgctttcttc
gacatcgaccagtgcagcgaccgcacctcgccctacgaccacatgctgcccggggccgag
catttcgcggagtacgcaggccgcctgggcgtgggcgcggccacccacgtcgtgatctac
gacgccagcgaccagggcctctactccgccccgcgcgtctggtggatgttccgcgccttc
ggccaccacgccgtgtcactgcttgatggcggcctccgccactggctgcgccagaacctc
ccgctcagctccggcaagagccaacctgctcccgccgagttccgcgctcagctcgacccc
gccttcatcaagacctacgaggacatcaaggagaacctggaatcccggcgcttccaggtg
gtggactcccgagccactggcaggttccgcggcaccgagcccgagccccgagacggcatt
gaacctggccacatcccaggtaccgtgaacatccccttcacagacttcctgagccaggag
gggctggagaagagccctgaggagatccgccatctgttccaggagaagaaagtggacctg
tctaagccactggtggccacgtgtggctctggcgtcacagcctgccacgtggcactaggg
gcctacctctgcggcaagccagacgtgcccatctacgatggctcctgggtggagtggtac
atgcgcgcccggcccgaggatgtcatctcagagggccgggggaagacccactga

DBGET integrated database retrieval system