KEGG   Homo sapiens (human): 4363Help
Entry
4363              CDS       T01001                                 

Gene name
ABCC1, ABC29, ABCC, GS-X, MRP, MRP1
Definition
(RefSeq) ATP binding cassette subfamily C member 1
  KO
K05665  ATP-binding cassette, subfamily C (CFTR/MRP), member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa02010  ABC transporters
hsa04071  Sphingolipid signaling pathway
hsa04977  Vitamin digestion and absorption
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    4363 (ABCC1)
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    4363 (ABCC1)
 09150 Organismal Systems
  09154 Digestive system
   04977 Vitamin digestion and absorption
    4363 (ABCC1)
 09160 Human Diseases
  09161 Cancers
   05206 MicroRNAs in cancer
    4363 (ABCC1)
  09168 Drug resistance
   01523 Antifolate resistance
    4363 (ABCC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    4363 (ABCC1)
Transporters [BR:hsa02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    4363 (ABCC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N MMR_HSR1 PHO4 AAA_16 RsgA_GTPase AAA_25 AAA_22 AAA_29 ABC_ATPase Zeta_toxin Dynamin_N
Motif
Other DBs
NCBI-GeneID: 4363
NCBI-ProteinID: NP_004987
OMIM: 158343
HGNC: 51
Ensembl: ENSG00000103222
Vega: OTTHUMG00000048267
Pharos: P33527(Tchem)
UniProt: P33527
Structure
PDB: 

Position
16p13.11
AA seq 1531 aa AA seqDB search
MALRGFCSADGSDPLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRH
DRGYIQMTPLNKTKTALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLA
TFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFS
LLLIQLVLSCFSDRSPLFSETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSD
LWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEAL
IVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD
WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTV
GEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVN
AVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLK
KSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILP
MVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPT
LNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQND
SLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLAR
AVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIV
MSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGM
LVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKL
SVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYG
ALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKEL
DTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQL
KRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLA
VRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVA
VERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGG
EKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLF
SGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCL
ARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVL
DKGEIQEYGAPSDLLQQRGLFYSMAKDAGLV
NT seq 4596 nt NT seq  +upstreamnt  +downstreamnt
atggcgctccggggcttctgcagcgccgatggctccgacccgctctgggactggaatgtc
acgtggaataccagcaaccccgacttcaccaagtgctttcagaacacggtcctcgtgtgg
gtgccttgtttttacctctgggcctgtttccccttctacttcctctatctctcccgacat
gaccgaggctacattcagatgacacctctcaacaaaaccaaaactgccttgggatttttg
ctgtggatcgtctgctgggcagacctcttctactctttctgggaaagaagtcggggcata
ttcctggccccagtgtttctggtcagcccaactctcttgggcatcaccatgctgcttgct
acctttttaattcagctggagaggaggaagggagttcagtcttcagggatcatgctcact
ttctggctggtagccctagtgtgtgccctagccatcctgagatccaaaattatgacagcc
ttaaaagaggatgcccaggtggacctgtttcgtgacatcactttctacgtctacttttcc
ctcttactcattcagctcgtcttgtcctgtttctcagatcgctcacccctgttctcggaa
accatccacgaccctaatccctgcccagagtccagcgcttccttcctgtcgaggatcacc
ttctggtggatcacagggttgattgtccggggctaccgccagcccctggagggcagtgac
ctctggtccttaaacaaggaggacacgtcggaacaagtcgtgcctgttttggtaaagaac
tggaagaaggaatgcgccaagactaggaagcagccggtgaaggttgtgtactcctccaag
gatcctgcccagccgaaagagagttccaaggtggatgcgaatgaggaggtggaggctttg
atcgtcaagtccccacagaaggagtggaacccctctctgtttaaggtgttatacaagacc
tttgggccctacttcctcatgagcttcttcttcaaggccatccacgacctgatgatgttt
tccgggccgcagatcttaaagttgctcatcaagttcgtgaatgacacgaaggccccagac
tggcagggctacttctacaccgtgctgctgtttgtcactgcctgcctgcagaccctcgtg
ctgcaccagtacttccacatctgcttcgtcagtggcatgaggatcaagaccgctgtcatt
ggggctgtctatcggaaggccctggtgatcaccaattcagccagaaaatcctccacggtc
ggggagattgtcaacctcatgtctgtggacgctcagaggttcatggacttggccacgtac
attaacatgatctggtcagcccccctgcaagtcatccttgctctctacctcctgtggctg
aatctgggcccttccgtcctggctggagtggcggtgatggtcctcatggtgcccgtcaat
gctgtgatggcgatgaagaccaagacgtatcaggtggcccacatgaagagcaaagacaat
cggatcaagctgatgaacgaaattctcaatgggatcaaagtgctaaagctttatgcctgg
gagctggcattcaaggacaaggtgctggccatcaggcaggaggagctgaaggtgctgaag
aagtctgcctacctgtcagccgtgggcaccttcacctgggtctgcacgccctttctggtg
gccttgtgcacatttgccgtctacgtgaccattgacgagaacaacatcctggatgcccag
acagccttcgtgtctttggccttgttcaacatcctccggtttcccctgaacattctcccc
atggtcatcagcagcatcgtgcaggcgagtgtctccctcaaacgcctgaggatctttctc
tcccatgaggagctggaacctgacagcatcgagcgacggcctgtcaaagacggcgggggc
acgaacagcatcaccgtgaggaatgccacattcacctgggccaggagcgaccctcccaca
ctgaatggcatcaccttctccatccccgaaggtgctttggtggccgtggtgggccaggtg
ggctgcggaaagtcgtccctgctctcagccctcttggctgagatggacaaagtggagggg
cacgtggctatcaagggctccgtggcctatgtgccacagcaggcctggattcagaatgat
tctctccgagaaaacatcctttttggatgtcagctggaggaaccatattacaggtccgtg
atacaggcctgtgccctcctcccagacctggaaatcctgcccagtggggatcggacagag
attggcgagaagggcgtgaacctgtctgggggccagaagcagcgcgtgagcctggcccgg
gccgtgtactccaacgctgacatttacctcttcgatgatcccctctcagcagtggatgcc
catgtgggaaaacacatctttgaaaatgtgattggccccaaggggatgctgaagaacaag
acgcggatcttggtcacgcacagcatgagctacttgccgcaggtggacgtcatcatcgtc
atgagtggcggcaagatctctgagatgggctcctaccaggagctgctggctcgagacggc
gccttcgctgagttcctgcgtacctatgccagcacagagcaggagcaggatgcagaggag
aacggggtcacgggcgtcagcggtccagggaaggaagcaaagcaaatggagaatggcatg
ctggtgacggacagtgcagggaagcaactgcagagacagctcagcagctcctcctcctat
agtggggacatcagcaggcaccacaacagcaccgcagaactgcagaaagctgaggccaag
aaggaggagacctggaagctgatggaggctgacaaggcgcagacagggcaggtcaagctt
tccgtgtactgggactacatgaaggccatcggactcttcatctccttcctcagcatcttc
cttttcatgtgtaaccatgtgtccgcgctggcttccaactattggctcagcctctggact
gatgaccccatcgtcaacgggactcaggagcacacgaaagtccggctgagcgtctatgga
gccctgggcatttcacaagggatcgccgtgtttggctactccatggccgtgtccatcggg
gggatcttggcttcccgctgtctgcacgtggacctgctgcacagcatcctgcggtcaccc
atgagcttctttgagcggacccccagtgggaacctggtgaaccgcttctccaaggagctg
gacacagtggactccatgatcccggaggtcatcaagatgttcatgggctccctgttcaac
gtcattggtgcctgcatcgttatcctgctggccacgcccatcgccgccatcatcatcccg
ccccttggcctcatctacttcttcgtccagaggttctacgtggcttcctcccggcagctg
aagcgcctcgagtcggtcagccgctccccggtctattcccatttcaacgagaccttgctg
ggggtcagcgtcattcgagccttcgaggagcaggagcgcttcatccaccagagtgacctg
aaggtggacgagaaccagaaggcctattaccccagcatcgtggccaacaggtggctggcc
gtgcggctggagtgtgtgggcaactgcatcgttctgtttgctgccctgtttgcggtgatc
tccaggcacagcctcagtgctggcttggtgggcctctcagtgtcttactcattgcaggtc
accacgtacttgaactggctggttcggatgtcatctgaaatggaaaccaacatcgtggcc
gtggagaggctcaaggagtattcagagactgagaaggaggcgccctggcaaatccaggag
acagctccgcccagcagctggccccaggtgggccgagtggaattccggaactactgcctg
cgctaccgagaggacctggacttcgttctcaggcacatcaatgtcacgatcaatggggga
gaaaaggtcggcatcgtggggcggacgggagctgggaagtcgtccctgaccctgggctta
tttcggatcaacgagtctgccgaaggagagatcatcatcgatggcatcaacatcgccaag
atcggcctgcacgacctccgcttcaagatcaccatcatcccccaggaccctgttttgttt
tcgggttccctccgaatgaacctggacccattcagccagtactcggatgaagaagtctgg
acgtccctggagctggcccacctgaaggacttcgtgtcagcccttcctgacaagctagac
catgaatgtgcagaaggcggggagaacctcagtgtcgggcagcgccagcttgtgtgccta
gcccgggccctgctgaggaagacgaagatccttgtgttggatgaggccacggcagccgtg
gacctggaaacggacgacctcatccagtccaccatccggacacagttcgaggactgcacc
gtcctcaccatcgcccaccggctcaacaccatcatggactacacaagggtgatcgtcttg
gacaaaggagaaatccaggagtacggcgccccatcggacctcctgcagcagagaggtctt
ttctacagcatggccaaagacgccggcttggtgtga

DBGET integrated database retrieval system