KEGG   Homo sapiens (human): 438Help
Entry
438               CDS       T01001                                 

Gene name
ASMT, ASMTY, HIOMT, HIOMTY
Definition
(RefSeq) acetylserotonin O-methyltransferase
  KO
K00543  acetylserotonin O-methyltransferase [EC:2.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00380  Tryptophan metabolism
hsa01100  Metabolic pathways
Module
hsa_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    438 (ASMT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.4  acetylserotonin O-methyltransferase
     438 (ASMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_2 Dimerisation2 Methyltransf_11 Methyltransf_12 Methyltransf_25 Methyltransf_23 Methyltransf_31 DUF1725 Dimerisation
Motif
Other DBs
NCBI-GeneID: 438
NCBI-ProteinID: NP_001164509
OMIM: 300015 402500
HGNC: 750
Ensembl: ENSG00000196433
Vega: OTTHUMG00000021065
Pharos: P46597(Tbio)
UniProt: P46597 A0A024RBT9
Structure
PDB: 

Position
Xp22.33 and Yp11.2
AA seq 373 aa AA seqDB search
MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGT
ELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHL
ADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDLSVF
PLMCDLGGTWIKLETIILSKLSQGQKTKHRVFSLIGGAGALAKECMSLYPGCKITVFDIP
EVVWTAKQHFSFQEEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLERIYHT
CKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGFRDFQFK
KTGAIYDAILARK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgggatcctcagaggaccaggcctatcgcctccttaatgactacgccaacggcttcatg
gtgtcccaggttctcttcgccgcctgcgagctgggcgtgtttgaccttctcgccgaggcc
ccagggcccctggacgtggcggcagtggctgcaggtgtgagggccagcgcccatgggaca
gagctcctgctggacatctgtgtgtccctgaagctgctgaaagtggagacgaggggagga
aaagctttctatcgaaacacagagctgtccagcgactacctgaccacggtcagcccgacg
tcacaatgcagcatgctgaagtacatgggcaggaccagctaccggtgctggggccacctg
gcagacgccgtgagagaaggaaggaaccagtacctggagacgtttggcgttcccgctgaa
gagctttttacggccatctacaggtccgagggcgagcggctacagttcatgcaagctctg
caggaggtctggagcgtcaacgggagaagcgtgctgaccgcctttgacctgtcagtgttc
ccacttatgtgtgaccttggtgggacatggataaagctggaaaccatcattctcagcaaa
ctatcgcaaggacagaaaaccaaacaccgcgtgttctcactcataggtggggctggagct
ctggctaaggaatgcatgtctctgtaccctggatgtaagatcaccgtttttgacatccca
gaagtggtgtggacggcaaagcagcacttctcattccaggaggaagaacagattgacttc
caggaaggggatttcttcaaagaccctcttccggaagctgatctgtacatcctggccagg
gtcctccatgactgggcagacggaaagtgctcacacctgctggagaggatctaccacact
tgcaagccaggtggtggcattctggtaattgaaagcctcctggatgaagacaggcgaggt
cctctgctcacgcagctctactctctgaacatgcttgtgcagacggaagggcaggagagg
acccccacccactaccacatgctcctctcttctgctggcttcagagacttccagtttaag
aaaacaggagccatttatgatgccattttagccaggaaataa

DBGET integrated database retrieval system