KEGG   Homo sapiens (human): 43847Help
Entry
43847             CDS       T01001                                 

Gene name
KLK14, KLK-L6
Definition
(RefSeq) kallikrein related peptidase 14
  KO
K09622  kallikrein 14 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    43847 (KLK14)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     43847 (KLK14)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   43847 (KLK14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 43847
NCBI-ProteinID: NP_001298111
OMIM: 606135
HGNC: 6362
Ensembl: ENSG00000129437
Vega: OTTHUMG00000143721
Pharos: Q9P0G3(Tchem)
UniProt: Q9P0G3 A0A024R4M6
Position
19q13.41
AA seq 251 aa AA seqDB search
MFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGGALLSGQ
WVITAAHCGRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQP
ARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQCVNINISPDEVCQKAYP
RTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKY
RSWIEETMRDK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgttcctcctgctgacagcacttcaagtcctggctatagccatgacacagagccaagag
gatgagaacaagataattggtggccatacgtgcacccggagctcccagccgtggcaggcg
gccctgctggcgggtcccaggcgccgcttcctctgcggaggcgccctgctttcaggccag
tgggtcatcactgctgctcactgcggccgcccgatccttcaggttgccctgggcaagcac
aacctgaggaggtgggaggccacccagcaggtgctgcgcgtggttcgtcaggtgacgcac
cccaactacaactcccggacccacgacaacgacctcatgctgctgcagctacagcagccc
gcacggatcgggagggcagtcaggcccattgaggtcacccaggcctgtgccagccccggg
acctcctgccgagtgtcaggctggggaactatatccagccccatcgccaggtaccccgcc
tctctgcaatgcgtgaacatcaacatctccccggatgaggtgtgccagaaggcctatcct
agaaccatcacgcctggcatggtctgtgcaggagttccccagggcgggaaggactcttgt
cagggtgactctgggggacccctggtgtgcagaggacagctccagggcctcgtgtcttgg
ggaatggagcgctgcgccctgcctggctaccccggtgtctacaccaacctgtgcaagtac
agaagctggattgaggaaacgatgcgggacaaatga

DBGET integrated database retrieval system