KEGG   Homo sapiens (human): 439
Entry
439               CDS       T01001                                 

Gene name
GET3, ARSA-I, ARSA1, ASNA-I, ASNA1, TRC40
Definition
(RefSeq) guided entry of tail-anchored proteins factor 3, ATPase
  KO
K01551  arsenite/tail-anchored protein-transporting ATPase [EC:7.3.2.7 7.3.-.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    439 (GET3)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    439 (GET3)
Enzymes [BR:hsa01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.7  arsenite-transporting ATPase
     439 (GET3)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Golgi to ER traffic proteins (GET)
    439 (GET3)
Transporters [BR:hsa02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   439 (GET3)
SSDB
Motif
Pfam: ArsA_ATPase AAA_31 CbiA ParA Fer4_NifH CBP_BcsQ SRP54 AAA_25 PhoH Zeta_toxin NB-ARC AAA_18
Other DBs
NCBI-GeneID: 439
NCBI-ProteinID: NP_004308
OMIM: 601913
HGNC: 752
Ensembl: ENSG00000198356
Vega: OTTHUMG00000180355
Pharos: O43681(Tbio)
UniProt: O43681
Position
19p13.13
AA seq 348 aa
MAAGVAGWGVEAEEFEDAPDVEPLEPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQ
LSKGRESVLIISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPSLGVAELPDEFFE
EDNMLSMGKKMMQEAMSAFPGIDEAMSYAEVMRLVKGMNFSVVVFDTAPTGHTLRLLNFP
TIVERGLGRLMQIKNQISPFISQMCNMLGLGDMNADQLASKLEETLPVIRSVSEQFKDPE
QTTFICVCIAEFLSLYETERLIQELAKCKIDTHNIIVNQLVFPDPEKPCKMCEARHKIQA
KYLDQMEDLYEDFHIVKLPLLPHEVRGADKVNTFSALLLEPYKPPSAQ
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggcggcaggggtggccgggtggggggttgaggcagaggagttcgaagatgctcctgat
gtggagccgctggagcctacacttagcaacatcatcgagcagcgcagcctgaagtggatc
ttcgtcgggggcaagggtggtgtgggcaagaccacctgcagctgcagcctggcagtccag
ctctccaaggggcgtgagagtgttctgatcatctccacagacccagcacacaacatctca
gatgcttttgaccagaagttctcaaaggtgcctaccaaggtcaaaggctatgacaacctc
tttgctatggagattgaccccagcctgggcgtggcggagctgcctgacgagttcttcgag
gaggacaacatgctgagcatgggcaagaagatgatgcaggaggccatgagcgcatttccc
ggcatcgatgaggccatgagctatgccgaggtcatgaggctggtgaagggcatgaacttc
tcggtggtggtatttgacacggcacccacgggccacaccctgaggctgctcaacttcccc
accatcgtggagcggggcctgggccggcttatgcagatcaagaaccagatcagccctttc
atctcacagatgtgcaacatgctgggcctgggggacatgaacgcagaccagctggcctcc
aagctggaggagacgctgcccgtcatccgctcagtcagcgaacagttcaaggaccctgag
cagacaactttcatctgcgtatgcattgctgagttcctgtccctgtatgagacagagagg
ctgatccaggagctggccaagtgcaagattgacacacacaatataattgtcaaccagctc
gtcttccccgaccccgagaagccctgcaagatgtgtgaggcccgtcacaagatccaggcc
aagtatctggaccagatggaggacctgtatgaagacttccacatcgtgaagctgccgctg
ttaccccatgaggtgcggggggcagacaaggtcaacaccttctcggccctcctcctggag
ccctacaagccccccagtgcccagtag

DBGET integrated database retrieval system