KEGG   Homo sapiens (human): 440Help
Entry
440               CDS       T01001                                 

Gene name
ASNS, ASNSD, TS11
Definition
(RefSeq) asparagine synthetase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00250  Alanine, aspartate and glutamate metabolism
hsa01100  Metabolic pathways
Disease
H01386  Asparagine synthetase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    440 (ASNS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     440 (ASNS)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C44
   440 (ASNS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 tRNA_Me_trans NAD_synthase Cloacin_immun QueC
Motif
Other DBs
NCBI-GeneID: 440
NCBI-ProteinID: NP_001664
OMIM: 108370
HGNC: 753
Ensembl: ENSG00000070669
Vega: OTTHUMG00000022892
Pharos: P08243(Tchem)
UniProt: P08243
Position
7q21.3
AA seq 561 aa AA seqDB search
MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQ
PIRVKKYPYLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGV
FAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPF
LPGHYEVLDLKPNGKVASVEMVKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFN
NAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAAR
KVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVV
IFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF
LDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNS
WFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPK
WINATDPSARTLTHYKSAVKA
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatttgggcgctgtttggcagtgatgattgcctttctgttcagtgtctgagt
gctatgaagattgcacacagaggtccagatgcattccgttttgagaatgtcaatggatac
accaactgctgctttggatttcaccggttggcggtagttgacccgctgtttggaatgcag
ccaattcgagtgaagaaatatccgtatttgtggctctgttacaatggtgaaatctacaac
cataagaagatgcaacagcattttgaatttgaataccagaccaaagtggatggtgagata
atccttcatctttatgacaaaggaggaattgagcaaacaatttgtatgttggatggtgtg
tttgcatttgttttactggatactgccaataagaaagtgttcctgggtagagatacatat
ggagtcagacctttgtttaaagcaatgacagaagatggatttttggctgtatgttcagaa
gctaaaggtcttgttacattgaagcactccgcgactccctttttaaaagtggagcctttt
cttcctggacactatgaagttttggatttaaagccaaatggcaaagttgcatccgtggaa
atggttaaatatcatcactgtcgggatgtacccctgcacgccctctatgacaatgtggag
aaactctttccaggttttgagatagaaactgtgaagaacaacctcaggatcctttttaat
aatgctgtaaagaaacgtttgatgacagacagaaggattggctgccttttatcagggggc
ttggactccagcttggttgctgccactctgttgaagcagctgaaagaagcccaagtacag
tatcctctccagacatttgcaattggcatggaagacagccccgatttactggctgctaga
aaggtggcagatcatattggaagtgaacattatgaagtcctttttaactctgaggaaggc
attcaggctctggatgaagtcatattttccttggaaacttatgacattacaacagttcgt
gcttcagtaggtatgtatttaatttccaagtatattcggaagaacacagatagcgtggtg
atcttctctggagaaggatcagatgaacttacgcagggttacatatattttcacaaggct
ccttctcctgaaaaagccgaggaggagagtgagaggcttctgagggaactctatttgttt
gatgttctccgcgcagatcgaactactgctgcccatggtcttgaactgagagtcccattt
ctagatcatcgattttcttcctattacttgtctctgccaccagaaatgagaattccaaag
aatgggatagaaaaacatctcctgagagagacgtttgaggattccaatctgatacccaaa
gagattctctggcgaccaaaagaagccttcagtgatggaataacttcagttaagaattcc
tggtttaagattttacaggaatacgttgaacatcaggttgatgatgcaatgatggcaaat
gcagcccagaaatttcccttcaatactcctaaaaccaaagaaggatattactaccgtcaa
gtctttgaacgccattacccaggccgggctgactggctgagccattactggatgcccaag
tggatcaatgccactgacccttctgcccgcacgctgacccactacaagtcagctgtcaaa
gcttag

DBGET integrated database retrieval system