KEGG   Homo sapiens (human): 440
Entry
440               CDS       T01001                                 
Symbol
ASNS, ASNSD, TS11
Name
(RefSeq) asparagine synthetase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00250  Alanine, aspartate and glutamate metabolism
hsa01100  Metabolic pathways
hsa01230  Biosynthesis of amino acids
Disease
H01386  Asparagine synthetase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    440 (ASNS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    440 (ASNS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     440 (ASNS)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C44
   440 (ASNS)
SSDB
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 tRNA_Me_trans NAD_synthase QueC
Other DBs
NCBI-GeneID: 440
NCBI-ProteinID: NP_001664
OMIM: 108370
HGNC: 753
Ensembl: ENSG00000070669
Pharos: P08243(Tchem)
UniProt: P08243
Structure
Position
7:complement(97851677..97928441)
AA seq 561 aa
MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQ
PIRVKKYPYLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGV
FAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPF
LPGHYEVLDLKPNGKVASVEMVKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFN
NAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAAR
KVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVV
IFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF
LDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNS
WFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPK
WINATDPSARTLTHYKSAVKA
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgtgtggcatttgggcgctgtttggcagtgatgattgcctttctgttcagtgtctgagt
gctatgaagattgcacacagaggtccagatgcattccgttttgagaatgtcaatggatac
accaactgctgctttggatttcaccggttggcggtagttgacccgctgtttggaatgcag
ccaattcgagtgaagaaatatccgtatttgtggctctgttacaatggtgaaatctacaac
cataagaagatgcaacagcattttgaatttgaataccagaccaaagtggatggtgagata
atccttcatctttatgacaaaggaggaattgagcaaacaatttgtatgttggatggtgtg
tttgcatttgttttactggatactgccaataagaaagtgttcctgggtagagatacatat
ggagtcagacctttgtttaaagcaatgacagaagatggatttttggctgtatgttcagaa
gctaaaggtcttgttacattgaagcactccgcgactccctttttaaaagtggagcctttt
cttcctggacactatgaagttttggatttaaagccaaatggcaaagttgcatccgtggaa
atggttaaatatcatcactgtcgggatgtacccctgcacgccctctatgacaatgtggag
aaactctttccaggttttgagatagaaactgtgaagaacaacctcaggatcctttttaat
aatgctgtaaagaaacgtttgatgacagacagaaggattggctgccttttatcagggggc
ttggactccagcttggttgctgccactctgttgaagcagctgaaagaagcccaagtacag
tatcctctccagacatttgcaattggcatggaagacagccccgatttactggctgctaga
aaggtggcagatcatattggaagtgaacattatgaagtcctttttaactctgaggaaggc
attcaggctctggatgaagtcatattttccttggaaacttatgacattacaacagttcgt
gcttcagtaggtatgtatttaatttccaagtatattcggaagaacacagatagcgtggtg
atcttctctggagaaggatcagatgaacttacgcagggttacatatattttcacaaggct
ccttctcctgaaaaagccgaggaggagagtgagaggcttctgagggaactctatttgttt
gatgttctccgcgcagatcgaactactgctgcccatggtcttgaactgagagtcccattt
ctagatcatcgattttcttcctattacttgtctctgccaccagaaatgagaattccaaag
aatgggatagaaaaacatctcctgagagagacgtttgaggattccaatctgatacccaaa
gagattctctggcgaccaaaagaagccttcagtgatggaataacttcagttaagaattcc
tggtttaagattttacaggaatacgttgaacatcaggttgatgatgcaatgatggcaaat
gcagcccagaaatttcccttcaatactcctaaaaccaaagaaggatattactaccgtcaa
gtctttgaacgccattacccaggccgggctgactggctgagccattactggatgcccaag
tggatcaatgccactgacccttctgcccgcacgctgacccactacaagtcagctgtcaaa
gcttag

DBGET integrated database retrieval system