KEGG   Homo sapiens (human): 440051
Entry
440051            CDS       T01001                                 

Gene name
KRTAP5-11, KRTAP5-5, KRTAP5-6, KRTAP5.11
Definition
(RefSeq) keratin associated protein 5-11
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Keratin_B2_2
Other DBs
NCBI-GeneID: 440051
NCBI-ProteinID: NP_001005405
HGNC: 23606
Ensembl: ENSG00000204571
Vega: OTTHUMG00000057586
Pharos: Q6L8G4(Tdark)
UniProt: Q6L8G4
Position
11q13.4
AA seq 156 aa
MGCCGCSGGCGSGCGGCGSGSGGCGSGCGGCGSSCCVPICCCKPVCCCVPACSCSSCGSC
GGSKGGCGSCGSSKGGCGSCGCSQSNCCKPCCSSSGCGSFCCQSSCSKPCCCQSSCCQSS
CCKPCCCQSSCCQSSCFKPCCCQSSCCVPVCCQCKI
NT seq 471 nt   +upstreamnt  +downstreamnt
atgggctgctgtggctgttctggaggctgtggctctggctgtgggggctgtggctccggc
agtgggggctgtggctctggctgtgggggctgtggctccagctgctgtgtgcccatttgc
tgctgcaagcctgtgtgctgctgtgtgccagcctgttcctgctccagctgtggctcctgt
gggggctccaaagggggctgtggctcttgtgggagctccaagggtgggtgtggttcttgt
ggctgctcccagtccaactgctgtaagccctgctgctcctcctcaggctgtgggtcattc
tgctgccagtccagctgctccaaaccctgctgctgccaatccagctgctgccagtccagc
tgctgcaagccctgctgctgccaatccagctgctgccagtctagctgcttcaagccctgc
tgctgccagtccagctgctgtgtccccgtgtgctgccagtgtaagatctga

DBGET integrated database retrieval system