KEGG   Homo sapiens (human): 440073Help
Entry
440073            CDS       T01001                                 

Gene name
IQSEC3
Definition
(RefSeq) IQ motif and Sec7 domain ArfGEF 3
  KO
K12495  IQ motif and SEC7 domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    440073 (IQSEC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    440073 (IQSEC3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    440073 (IQSEC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 IQ_SEC7_PH bZIP_1 SlyX IQ
Motif
Other DBs
NCBI-GeneID: 440073
NCBI-ProteinID: NP_001164209
OMIM: 612118
HGNC: 29193
Ensembl: ENSG00000120645
Vega: OTTHUMG00000167975
Pharos: Q9UPP2(Tdark)
UniProt: Q9UPP2
Position
12p13.33
AA seq 1182 aa AA seqDB search
MESLLENPVRAVLYLKELTAIVQNQQSLIHTQRERIDELERRLDELSAENRSLWEHQQLL
QAQPPPGLVPPSSAPLPAAPATAPAAAARAQEPLQDQGQRSAAAPHPAPDRPPRQHHGQL
LEQPQRGPGSRAHTPQSPHKHLGTQGAVTDKEKERPPSCCAAAGALLQHKSPSALGKGVL
SRRPENETVLHQFCCPAADACSDLASQSDGSCTQAGGGMEDSVVAAAAVAAGRPSAHAPK
AQAQELQEEEERPGAGAASPRAGPQHKASPGRQQPALATALCPHAPAASDYELSLDLKNK
QIEMLEHKYGGHLVSRRAACTIQTAFRQYQLSKNFEKIRNSLLESRLPRRISLRKVRSPT
AESLAAEKALMEGYGLVGLPLVRSPSLPPTFAGTLTELEDSFTEQVQSLAKSIDDALSTW
SLKTMCSLRESGAYQLHQALQAAAGPPGLEAEGRAPESAGPGPGDDAAETPGLPPAHSGT
LMMAFRDVTVQIANQNISVSSSTALSVANCLGAQTVQAPAEPAAGKAEQGETSGREAPEA
PAVGREDASAEDSCAEAAASGAADGATAPKTEEEEEEEETAEVGRGAEAEAGDLEQLSSS
STSTKSAKSGSEASASASKDALQAMILSLPRYHCENPASCKSPTLSTDTLRKRLYRIGLN
LFNINPDKGIQFLISRGFIPDTPIGVAHFLLQRKGLSRQMIGEFLGNSKKQFNRDVLDCV
VDEMDFSSMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCMCNPEVVQQFHNPDTIF
ILAFAIILLNTDMYSPNIKPDRKMMLEDFIRNLRGVDDGADIPRELVVGIYERIQQKELK
SNEDHVTYVTKVEKSIVGMKTVLSVPHRRLVCCSRLFEVTDVNKLQKQAAHQREVFLFND
LLVILKLCPKKKSSSTYTFCKSVGLLGMQFQLFENEYYSHGITLVTPLSGSEKKQVLHFC
ALGSDEMQKFVEDLKESIAEVTELEQIRIEWELEKQQGTKTLSFKPCGAQGDPQSKQGSP
TAKREAALRERPAESTVEVSIHNRLQTSQHNSGLGAERGAPVPPPDLQPSPPRQQTPPLP
PPPPTPPGTLVQCQQIVKVIVLDKPCLARMEPLLSQALSCYTSSSSDSCGSTPLGGPGSP
VKVTHQPPLPPPPPPYNHPHQFCPPGSLLHGHRYSSGSRSLV
NT seq 3549 nt NT seq  +upstreamnt  +downstreamnt
atggagagcctgctggagaatccggtgcgcgccgtgctctacctcaaggagctcacggcc
atcgtgcagaaccagcagagcctcatccacacccagcgagagcgtatcgacgagctggag
cggcggctggacgagctgagcgctgagaaccgcagcctgtgggagcaccagcagctgctg
caagcccagcctccgcccgggctcgtccccccgtcatcggccccgctgccggccgctccg
gccaccgctcctgccgccgccgccagggcccaggaacctctccaggaccagggacagcgc
tcagcagccgcgccgcatcccgcgcccgatcggccgccgcgtcagcaccacggacagctc
ctggagcagccccagcggggccctggcagcagggctcacacaccccagtcgccccacaag
catctggggacacaaggggccgtgactgacaaggagaaggagcgtcccccgagttgctgc
gctgctgccggagccctccttcagcacaaatccccctccgccctcggcaagggcgtcctg
agcaggagacctgagaatgagaccgtgctgcaccagttctgctgcccagccgccgacgcc
tgctccgacctggcctcccaaagtgatggctcctgcacccaggccggtgggggcatggag
gactccgtggtggcagcggcggcggtggcagccggcagacccagtgcccatgccccgaag
gctcaagcccaggagctgcaggaggaggaggagcggccgggggcaggggctgcctcccca
agggctggcccccagcacaaggcctcccccggccggcagcagcctgccctggcgacggcg
ctgtgcccccacgcccctgccgcctccgattacgaactctcccttgacctaaagaataaa
cagattgaaatgctagaacataagtacggcggtcacctggtgtcccggcgcgccgcttgc
accatccaaaccgccttccgccaataccagctcagcaagaacttcgagaaaatccgcaac
tcgcttctggagagccgcctgccacggcggatctccctgcgcaaggtgcggtcacccacg
gccgagagcctggcggccgagaaagcgctcatggagggctacggcctcgtggggctgccg
ctggtgcgctcgccctccctgccgcccaccttcgcaggcaccctcaccgagctggaggac
tccttcaccgagcaggtgcaatccctggccaagtccatcgacgacgcgctcagcacgtgg
agcctcaagaccatgtgctccctgcgggagagtggcgcttaccagctccaccaggccctg
caggcggccgcggggcccccaggcctggaggccgaggggcgggcgccggagagcgcgggc
cccgggcccggggatgacgccgcggagacccccggcctgcccccggcccacagcgggacc
ctcatgatggctttccgggacgtcacggtgcagatcgccaaccagaacatatccgtctcc
tcctccacggctctgtcggtggccaactgcctgggcgctcagacggtccaggcccccgca
gagcccgcggcgggcaaggccgagcagggcgagacctctgggcgggaggccccggaagcc
cccgccgtgggccgggaggacgcgtcagccgaggactcatgcgcagaggctgcggctagt
ggggcggcggatggggccacagcccccaaaacagaggaggaagaggaggaggaggagacg
gcggaggtggggagaggggccgaggccgaggcaggcgacttggagcagctgagcagcagc
agcacgtccaccaagtccgccaagtcaggctcggaggcgtcggcctccgcctccaaggac
gccctgcaggccatgatcctgagcctgccgcgctaccactgcgagaacccagccagctgc
aagtcgcccacgctctccaccgacaccctgcgcaagcggctctaccgcatcggcctcaac
ctcttcaacataaaccccgacaagggcatccagttcctgatctcacgcggcttcatcccg
gacacccccatcggtgtggcccatttcctcctccagcgaaagggcctcagccgccagatg
attggagagttcctgggcaacagcaagaagcagttcaaccgcgacgtgctggactgcgtg
gtggacgagatggacttctccagcatggagctggacgaggccctgcgcaagttccaggca
cacatccgtgtgcagggggaggctcagaaggtggagcggctcattgaggccttcagccag
cgctactgcatgtgcaaccccgaagtggttcagcagttccacaaccccgacaccatcttc
atcctcgccttcgccatcatcctcctcaacaccgacatgtacagccccaacatcaagcct
gaccggaagatgatgctggaggacttcatccgaaaccttcgaggtgtggacgatggcgct
gacatccccagggagctggtggtaggcatctatgagaggatacagcagaaggagctcaag
tccaatgaggaccacgtcacgtacgtcaccaaggtggagaagtccattgtgggcatgaag
acagtgctgtccgtgccccaccgccgcctggtgtgctgcagccggctcttcgaggtgacg
gatgtgaacaagctgcagaagcaggcagcgcatcagagggaggtgttcctcttcaatgac
ctgctggtgattctcaaactttgcccgaagaagaagagctcctccacgtacaccttttgc
aagtcagttggcctgctgggcatgcagttccagctctttgagaacgagtattactctcat
ggcatcacactggtgaccccgctctcgggctccgagaagaagcaggtgctgcatttctgt
gccctgggctcggacgagatgcagaagttcgtggaggacctgaaggagtccattgctgag
gtgacggagctggagcagatccgaatagagtgggagctggagaagcagcagggaacaaag
acactctccttcaagccctgcggagcccagggggacccacagtcaaagcaaggatcgccg
acagccaaaagggaagccgcgctcagggagaggccggcggagagcacggtggaggtgtca
attcacaacaggcttcaaacgtcccagcacaactccgggctgggggccgagaggggagcg
ccggtgccgccgccagacctgcagcctagccccccgagacagcagaccccaccactgccg
ccgccgccacccacgcccccgggcaccctggtgcagtgccagcaaattgtcaaggtcatt
gtcctggacaagccctgcctggcccgcatggagcccctgctgagccaggctctctcctgc
tacacctcgtcgtcctctgactcctgcggctccacacccctgggcggtcccggctctccg
gtcaaggtcacccaccagcctccgctgcccccgcccccacccccctacaaccaccctcac
cagttctgtcccccaggctccctgctgcacgggcaccgctactccagtggctcaaggagc
ctggtgtag

DBGET integrated database retrieval system