KEGG   Homo sapiens (human): 440275Help
Entry
440275            CDS       T01001                                 

Gene name
EIF2AK4, GCN2, PVOD2
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 4
  KO
K16196  eukaryotic translation initiation factor 2-alpha kinase 4 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa05160  Hepatitis C
hsa05162  Measles
hsa05168  Herpes simplex virus 1 infection
Network
nt06122  IFN signaling (viruses)
nt06163  Hepatitis C virus (HCV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00270  HCV Core to IFN signaling pathway
N00575  HSV ICP27 to IFN signaling pathway
N00576  HSV UL41/UL13 to IFN signaling pathway
N00577  HSV UL41 to IFN signaling pathway
N00578  HSV UL41 to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
Disease
H01621  Pulmonary arterial hypertension
H01866  Pulmonary veno-occlusive disease and pulmonary capillary hemangiomatosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    440275 (EIF2AK4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    440275 (EIF2AK4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    440275 (EIF2AK4)
   05160 Hepatitis C
    440275 (EIF2AK4)
   05168 Herpes simplex virus 1 infection
    440275 (EIF2AK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    440275 (EIF2AK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     440275 (EIF2AK4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   440275 (EIF2AK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RWD HGTP_anticodon2 tRNA-synt_His Kinase-like Kdo APH
Motif
Other DBs
NCBI-GeneID: 440275
NCBI-ProteinID: NP_001013725
OMIM: 609280
HGNC: 19687
Ensembl: ENSG00000128829
Vega: OTTHUMG00000172403
Pharos: Q9P2K8(Tchem)
UniProt: Q9P2K8
Structure
PDB: 

Position
15q15.1
AA seq 1649 aa AA seqDB search
MAGGRGAPGRGRDEPPESYPQRQDHELQALEAIYGADFQDLRPDACGPVKEPPEINLVLY
PQGLTGEEVYVKVDLRVKCPPTYPDVVPEIELKNAKGLSNESVNLLKSRLEELAKKHCGE
VMIFELAYHVQSFLSEHNKPPPKSFHEEMLERRAQEEQQRLLEAKRKEEQEQREILHEIQ
RRKEEIKEEKKRKEMAKQERLEIASLSNQDHTSKKDPGGHRTAAILHGGSPDFVGNGKHR
ANSSGRSRRERQYSVCNSEDSPGSCEILYFNMGSPDQLMVHKGKCIGSDEQLGKLVYNAL
ETATGGFVLLYEWVLQWQKKMGPFLTSQEKEKIDKCKKQIQGTETEFNSLVKLSHPNVVR
YLAMNLKEQDDSIVVDILVEHISGVSLAAHLSHSGPIPVHQLRRYTAQLLSGLDYLHSNS
VVHKVLSASNVLVDAEGTVKITDYSISKRLADICKEDVFEQTRVRFSDNALPYKTGKKGD
VWRLGLLLLSLSQGQECGEYPVTIPSDLPADFQDFLKKCVCLDDKERWSPQQLLKHSFIN
PQPKMPLVEQSPEDSEGQDYVETVIPSNRLPSAAFFSETQRQFSRYFIEFEELQLLGKGA
FGAVIKVQNKLDGCCYAVKRIPINPASRQFRRIKGEVTLLSRLHHENIVRYYNAWIERHE
RPAGPGTPPPDSGPLAKDDRAARGQPASDTDGLDSVEAAAPPPILSSSVEWSTSGERSAS
ARFPATGPGSSDDEDDDEDEHGGVFSQSFLPASDSESDIIFDNEDENSKSQNQDEDCNEK
NGCHESEPSVTTEAVHYLYIQMEYCEKSTLRDTIDQGLYRDTVRLWRLFREILDGLAYIH
EKGMIHRDLKPVNIFLDSDDHVKIGDFGLATDHLAFSADSKQDDQTGDLIKSDPSGHLTG
MVGTALYVSPEVQGSTKSAYNQKVDLFSLGIIFFEMSYHPMVTASERIFVLNQLRDPTSP
KFPEDFDDGEHAKQKSVISWLLNHDPAKRPTATELLKSELLPPPQMEESELHEVLHHTLT
NVDGKAYRTMMAQIFSQRISPAIDYTYDSDILKGNFSIRTAKMQQHVCETIIRIFKRHGA
VQLCTPLLLPRNRQIYEHNEAALFMDHSGMLVMLPFDLRIPFARYVARNNILNLKRYCIE
RVFRPRKLDRFHPKELLECAFDIVTSTTNSFLPTAEIIYTIYEIIQEFPALQERNYSIYL
NHTMLLKAILLHCGIPEDKLSQVYIILYDAVTEKLTRREVEAKFCNLSLSSNSLCRLYKF
IEQKGDLQDLMPTINSLIKQKTGIAQLVKYGLKDLEEVVGLLKKLGIKLQVLINLGLVYK
VQQHNGIIFQFVAFIKRRQRAVPEILAAGGRYDLLIPQFRGPQALGPVPTAIGVSIAIDK
ISAAVLNMEESVTISSCDLLVVSVGQMSMSRAINLTQKLWTAGITAEIMYDWSQSQEELQ
EYCRHHEITYVALVSDKEGSHVKVKSFEKERQTEKRVLETELVDHVLQKLRTKVTDERNG
REASDNLAVQNLKGSFSNASGLFEIHGATVVPIVSVLAPEKLSASTRRRYETQVQTRLQT
SLANLHQKSSEIEILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSRLPKQRYLKLVC
DEIYNIKVEKKVSVLFLYSYRDDYYRILF
NT seq 4950 nt NT seq  +upstreamnt  +downstreamnt
atggctgggggccgtggggcccccgggcgcggccgggacgagcctccggagagctacccg
caacgacaggaccacgagctacaggccctggaggccatttacggcgcggacttccaagac
ctgcggccggacgcttgcggaccggtcaaagagccccctgaaatcaatttagttttgtac
cctcaaggcctaactggtgaagaagtatatgtaaaagtggatttgagggttaaatgccca
cctacctatccagatgtagttcctgaaatagagttaaaaaatgccaaaggtctatcaaat
gaaagtgtcaatttgttaaaatctcgcctagaagaactggccaagaaacactgtggggag
gtgatgatctttgaactggcttaccacgtgcagtcatttctcagcgagcataacaagccc
cctcccaagtcttttcatgaagaaatgctggaaaggcgggctcaggaggagcagcagagg
ctgttggaggccaagcggaaagaagagcaggagcaacgtgaaatcctgcatgagattcag
agaaggaaagaagagataaaagaagagaaaaaaaggaaagaaatggctaagcaggaacgt
ttggaaattgctagtttgtcaaaccaagatcatacctctaagaaggacccaggaggacac
agaacggctgccattctacatggaggctctcctgactttgtaggaaatggtaaacatcgg
gcaaactcctcaggaaggtctaggcgagaacgtcagtattctgtatgtaatagtgaagat
tctcctggctcttgtgaaattctgtatttcaatatggggagtcctgatcagctcatggtg
cacaaagggaaatgtattggcagtgatgaacaacttggaaaattagtctacaatgctttg
gaaacagccactggtggctttgtcttgttgtatgagtgggtccttcagtggcagaaaaaa
atgggtccattccttaccagtcaagaaaaagagaagattgataagtgcaaaaagcagatt
caaggaacagaaacagaattcaactcactggtaaaattgagccatccaaatgtagtacgc
taccttgcaatgaatctcaaagagcaagacgactccatcgtggtggacattttagtggag
cacattagtggggtctctcttgctgcacacctgagccactcaggccccatccctgtgcat
cagcttcgcaggtacacagctcagctcctgtcaggccttgattatctgcacagcaattct
gtggtgcataaggtcctgagtgcatctaatgtcttggtggatgcagaaggcaccgtcaag
attacggactatagcatttctaagcgcctcgcagacatttgcaaggaggatgtgtttgag
caaacccgagttcgttttagtgacaatgctctgccttataaaacggggaagaaaggagat
gtttggcgtcttggccttctgctgctgtccctcagccaaggacaggaatgtggagagtac
cctgtgaccatccctagtgacttaccagctgactttcaagattttctaaagaaatgtgtg
tgcttggatgacaaggaaagatggagtccccagcagttgttgaaacacagctttataaat
ccccagccaaaaatgcctctagtggaacaaagtcctgaagattctgaaggacaagattat
gttgagactgttattcctagcaaccggctacccagtgctgccttctttagtgagacacag
agacagttttcccgatacttcattgagtttgaagaattacaacttcttggtaaaggagct
tttggagctgtcatcaaggtgcagaacaagttggacggctgctgctacgcagtgaagcgc
atccccatcaacccggccagccggcagttccgcaggatcaagggcgaagtgacactgctg
tcacggctgcaccatgagaacattgtgcgctactacaacgcctggatcgagcggcacgag
cggccggcgggaccggggacgccgcccccggactccgggcccctggccaaggatgaccga
gctgcacgcgggcagccggcgagcgacacagacggcctggacagcgtagaggccgccgcg
ccgccacccatcctcagcagctcggtggagtggagcacttcgggcgagcgctcggccagt
gcccgtttccccgccaccggcccgggctccagcgatgacgaggacgacgacgaggacgag
cacggtggcgtcttctcccagtccttcctgcctgcttcagattctgaaagtgatattatc
tttgacaatgaagatgagaacagtaaaagtcagaatcaggatgaagattgcaatgaaaag
aatggctgccatgaaagtgagccatcagtgacgactgaggctgtgcactacctatacatc
cagatggagtactgtgagaagagcactttacgagacaccattgaccagggactgtatcga
gacaccgtcagactctggaggctttttcgagagattctggatggattagcttatatccat
gagaaaggaatgattcaccgggatttgaagcctgtcaacatttttttggattctgatgac
catgtgaaaataggtgattttggtttggcgacagaccatctagccttttctgctgacagc
aaacaagacgatcagacaggagacttgattaagtcagacccttcaggtcacttaactggg
atggttggcactgctctctatgtaagcccagaggtccaaggaagcaccaaatctgcatac
aaccagaaagtggatctcttcagcctgggaattatcttctttgagatgtcctatcacccc
atggtcacggcttcagaaaggatctttgttctcaaccaactcagagatcccacttcgcct
aagtttccagaagactttgacgatggagagcatgcaaagcagaaatcagtcatctcctgg
ctgttgaaccacgatccagcaaaacggcccacagccacagaactgctcaagagtgagctg
ctgcccccaccccagatggaggagtcagagctgcatgaagtgctgcaccacacgctgacc
aacgtggatgggaaggcctaccgcaccatgatggcccagatcttctcgcagcgcatctcc
cctgccatcgattacacctatgacagcgacatactgaagggcaacttctcaatccgtaca
gccaagatgcagcagcatgtgtgtgaaaccatcatccgcatctttaaaagacatggagct
gttcagttgtgtactccactactgcttccccgaaacagacaaatatatgagcacaacgaa
gctgccctattcatggaccacagcgggatgctggtgatgcttccttttgacctgcggatc
ccttttgcaagatatgtggcaagaaataatatattgaatttaaaacgatactgcatagaa
cgtgtgttcaggccgcgcaagttagatcgatttcatcccaaagaacttctggagtgtgca
tttgatattgtcacttctaccaccaacagctttctgcccactgctgaaattatctacact
atctatgaaatcatccaagagtttccagcacttcaggaaagaaattacagtatttatttg
aaccataccatgttattgaaagcaatactcttacactgtgggatcccagaagataaactc
agtcaagtctacattattctgtatgatgctgtgacagagaagctgacgaggagagaagtg
gaagctaaattttgtaatctgtctttgtcttctaatagtctgtgtcgactctacaagttt
attgaacagaagggagatttgcaagatcttatgccaacaataaattcattaataaaacag
aaaacaggtattgcacagttggtgaagtatggcttaaaagacctagaggaggttgttgga
ctgttgaagaaactcggcatcaagttacaggtcttgatcaatttgggcttggtttacaag
gtgcagcagcacaatggaatcatcttccagtttgtggctttcatcaaacgaaggcaaagg
gctgtacctgaaatcctcgcagctggaggcagatatgacctgctgattccccagtttaga
gggccacaagctctggggccagttcccactgccattggggtcagcatagctatagacaag
atatctgctgctgtcctcaacatggaggaatctgttacaataagctcttgtgacctcctg
gttgtaagtgttggccagatgtctatgtccagggccatcaacctaacccagaaactctgg
acagcaggcatcacagcagaaatcatgtacgactggtcacagtcccaagaggaattacaa
gagtactgcagacatcatgaaatcacctatgtggcccttgtctcggataaagaaggaagc
catgtcaaggttaagtctttcgagaaggaaaggcagacagagaagcgtgtgctggagact
gaacttgtggaccatgtactgcagaaactgaggactaaagtcactgatgaaaggaatggc
agagaagcttccgataatcttgcagtgcaaaatctgaaggggtcattttctaatgcttca
ggtttgtttgaaatccatggagcaacagtggttcccattgtgagtgtgctagccccggag
aagctgtcagccagcactaggaggcgctatgaaactcaggtacaaactcgacttcagacc
tcccttgccaacttacatcagaaaagcagtgaaattgaaattctggctgtggatctaccc
aaagaaacaatattacagtttttatcattagagtgggatgctgatgaacaggcatttaac
acaactgtgaagcagctgctgtcacgcctgccaaagcaaagatacctcaaattagtctgt
gatgaaatttataacatcaaagtagaaaaaaaggtgtctgtgctatttctgtacagctat
agagatgactactacagaatcttattttaa

DBGET integrated database retrieval system