KEGG   Homo sapiens (human): 440279Help
Entry
440279            CDS       T01001                                 

Gene name
UNC13C
Definition
(RefSeq) unc-13 homolog C
  KO
K15293  protein unc-13 A/B/C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    440279 (UNC13C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    440279 (UNC13C)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    440279 (UNC13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Membr_traf_MHD C2 DUF1041 C1_1 FCH DUF2205 Med9
Motif
Other DBs
NCBI-GeneID: 440279
NCBI-ProteinID: NP_001074003
OMIM: 614568
HGNC: 23149
Ensembl: ENSG00000137766
Vega: OTTHUMG00000172542
Pharos: Q8NB66(Tdark)
UniProt: Q8NB66
Position
15q21.3
AA seq 2214 aa AA seqDB search
MVANFFKSLILPYIHKLCKGMFTKKLGNTNKNKEYRQQKKDQDFPTAGQTKSPKFSYTFK
STVKKIAKCSSTHNLSTEEDEASKEFSLSPTFSYRVAIANGLQKNAKVTNSDNEDLLQEL
SSIESSYSESLNELRSSTENQAQSTHTMPVRRNRKSSSSLAPSEGSSDGERTLHGLKLGA
LRKLRKWKKSQECVSSDSELSTMKKSWGIRSKSLDRTVRNPKTNALEPGFSSSGCISQTH
DVMEMIFKELQGISQIETELSELRGHVNALKHSIDEISSSVEVVQSEIEQLRTGFVQSRR
ETRDIHDYIKHLGHMGSKASLRFLNVTEERFEYVESVVYQILIDKMGFSDAPNAIKIEFA
QRIGHQRDCPNAKPRPILVYFETPQQRDSVLKKSYKLKGTGIGISTDILTHDIRERKEKG
IPSSQTYESMAIKLSTPEPKIKKNNWQSPDDSDEDLESDLNRNSYAVLSKSELLTKGSTS
KPSSKSHSARSKNKTANSSRISNKSDYDKISSQLPESDILEKQTTTHYADATPLWHSQSD
FFTAKLSRSESDFSKLCQSYSEDFSENQFFTRTNGSSLLSSSDRELWQRKQEGTATLYDS
PKDQHLNGGVQGIQGQTETENTETVDSGMSNGMVCASGDRSHYSDSQLSLHEDLSPWKEW
NQGADLGLDSSTQEGFDYETNSLFDQQLDVYNKDLEYLGKCHSDLQDDSESYDLTQDDNS
SPCPGLDNEPQGQWVGQYDSYQGANSNELYQNQNQLSMMYRSQSELQSDDSEDAPPKSWH
SRLSIDLSDKTFSFPKFGSTLQRAKSALEVVWNKSTQSLSGYEDSGSSLMGRFRTLSQST
ANESSTTLDSDVYTEPYYYKAEDEEDYTEPVADNETDYVEVMEQVLAKLENRTSITETDE
QMQAYDHLSYETPYETPQDEGYDGPADDMVSEEGLEPLNETSAEMEIREDENQNIPEQPV
EITKPKRIRPSFKEAALRAYKKQMAELEEKILAGDSSSVDEKARIVSGNDLDASKFSALQ
VCGGAGGGLYGIDSMPDLRRKKTLPIVRDVAMTLAARKSGLSLAMVIRTSLNNEELKMHV
FKKTLQALIYPMSSTIPHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHEKCQ
DLLNADCLQRAAEKSSKHGAEDKTQTIITAMKERMKIREKNRPEVFEVIQEMFQISKEDF
VQFTKAAKQSVLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVGKNKRRTKTIF
GNLNPVWDEKFYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIVEVRTLS
GEMDVWYNLEKRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENLFHYLTEVKSN
GGVKIPEVKGDEAWKVFFDDASQEIVDEFAMRYGIESIYQAMTHFSCLSSKYMCPGVPAV
MSTLLANINAFYAHTTVSTNIQVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSKYREN
FPASNTERLQDLKSTVDLLTSITFFRMKVLELQSPPKASMVVKDCVRACLDSTYKYIFDN
CHELYSQLTDPSKKQDIPREDQGPTTKNLDFWPQLITLMVTIIDEDKTAYTPVLNQFPQE
LNMGKISAEIMWTLFALDMKYALEEHENQRLCKSTDYMNLHFKVKWFYNEYVRELPAFKD
AVPEYSLWFEPFVMQWLDENEDVSMEFLHGALGRDKKDGFQQTSEHALFSCSVVDVFAQL
NQSFEIIKKLECPNPEALSHLMRRFAKTINKVLLQYAAIVSSDFSSHCDKENVPCILMNN
IQQLRVQLEKMFESMGGKELDSEASTILKELQVKLSGVLDELSVTYGESFQVIIEECIKQ
MSFELNQMRANGNTTSNKNSAAMDAEIVLRSLMDFLDKTLSLSAKICEKTVLKRVLKELW
KLVLNKIEKQIVLPPLTDQTGPQMIFIAAKDLGQLSKLKEHMIREDARGLTPRQCAIMEV
VLATIKQYFHAGGNGLKKNFLEKSPDLQSLRYALSLYTQTTDALIKKFIDTQTSQSRSSK
DAVGQISVHVDITATPGTGDHKVTVKVIAINDLNWQTTAMFRPFVEVCILGPNLGDKKRK
QGTKTKSNTWSPKYNETFQFILGKENRPGAYELHLSVKDYCFAREDRIIGMTVIQLQNIA
EKGSYGAWYPLLKNISMDETGLTILRILSQRTSDDVAKEFVRLKSETRSTEESA
NT seq 6645 nt NT seq  +upstreamnt  +downstreamnt
atggtggctaattttttcaagagcttgattttaccttacattcataagctttgcaaagga
atgtttacaaagaaattgggaaatacaaacaaaaacaaagagtatcgtcagcagaaaaag
gatcaagacttccccactgctggccagaccaaatcccccaaattttcttacacttttaaa
agcactgtaaagaagattgcaaagtgttcatccactcacaacttatccactgaggaagac
gaggccagtaaagagttttccctctcaccaacattcagttaccgagtagctattgccaat
ggcctacaaaagaatgctaaagtaaccaacagtgataatgaggatctgcttcaagagctc
tcttcaatcgagagttcctactcagaatcattaaatgaactaaggagtagcacagaaaac
caggcacaatcaacacacacaatgccagttagacgcaacagaaagagttcaagcagcctt
gcaccctctgagggcagctctgacggggagcgtactctacatggcttaaaactgggagct
ttacgaaaactgagaaaatggaaaaagagtcaagaatgtgtctcctcagactcagagtta
agcaccatgaaaaaatcctggggaataagaagtaagtctttggacagaactgtccgaaac
ccaaagacaaatgccctggagccagggttcagttcctctggctgcattagccaaacacat
gatgtcatggaaatgatctttaaggaacttcagggaataagtcagattgaaacagaactt
tctgaactacgagggcacgtcaatgctctcaagcactccatcgatgagatctccagcagt
gtggaggttgtacaaagtgaaattgagcagttgcgcacagggtttgtccagtctcggagg
gaaactagagacatccatgattatattaagcacttaggtcatatgggtagcaaggcaagc
ctgagatttttaaatgtgactgaagaaagatttgaatatgttgaaagcgtggtgtaccaa
attctaatagataaaatgggtttttcagatgcaccaaatgctattaaaattgaatttgct
cagaggataggacaccagagagactgcccaaatgcaaagcctcgacccatacttgtgtac
tttgaaacccctcaacaaagggattctgtcttaaaaaagtcatataaactcaaaggaaca
ggcattggaatctcaacagatattctaactcatgacatcagagaaagaaaagagaaaggg
ataccatcctcccagacatatgagagcatggctataaagttgtctactccagagccaaaa
atcaagaagaacaattggcagtcacctgatgacagtgatgaagatcttgaatctgacctc
aatagaaacagttacgctgtgctttccaagtcagagcttctaacaaagggaagtacttcc
aagccaagctcaaaatcacacagtgctagatccaagaataaaactgctaatagcagcaga
atttcaaataaatcagattatgataaaatctcctcacagttgccagaatcagatatcttg
gaaaagcaaaccacaacccattatgcagatgcaacacctctctggcactcacagagtgat
tttttcactgctaaacttagtcgttctgaatcagatttttccaaattgtgtcagtcttac
tcagaagatttttcagaaaatcagtttttcactagaactaatggaagctctctcctgtca
tcttcggaccgggagctatggcagaggaaacaggaaggaacagcgaccctgtatgacagt
cccaaggaccagcatttgaatggaggtgttcagggtatccaagggcagactgaaactgaa
aacacagaaactgtggatagtggaatgagtaatggcatggtgtgtgcatctggagaccgg
agtcattacagtgattctcagctctctttacatgaggatctttctccatggaaggaatgg
aatcaaggagctgatttaggcttggattcatccacccaggaaggttttgattatgaaaca
aacagtctttttgaccaacagcttgatgtttacaataaagacctagaatacttgggaaag
tgccacagtgatcttcaagatgactcagagagctacgacttaactcaagatgacaattct
tctccatgccctggcttggataatgaaccacaaggccagtgggttggccaatatgattct
tatcagggagctaattctaatgagctataccaaaatcaaaaccagttgtccatgatgtat
cgaagtcaaagtgaattgcaaagtgatgattcagaggatgccccacccaaatcatggcat
agtcgattaagcattgacctttctgataagactttcagcttcccaaaatttggatctaca
ctgcagagggctaaatcagccttggaagtagtatggaacaaaagcacacagagtctgagt
gggtatgaggacagtggctcttcattaatggggagatttcggacattatctcaatcaact
gcaaatgagtcaagtaccacacttgactctgatgtctacacggagccctattactataaa
gcagaggatgaggaagattatactgaaccagtggctgacaatgaaacagattatgttgaa
gtcatggaacaagtccttgctaaactagaaaacaggactagtattactgaaacagatgaa
caaatgcaagcatatgatcacctttcatatgaaacaccttatgaaaccccacaagatgag
ggttatgatggtccagcagatgatatggttagtgaagaggggttagaacccttaaatgaa
acatcagctgagatggaaataagagaagatgaaaaccaaaacattcctgaacagccagtg
gagatcacaaagccaaagagaattcgtccttctttcaaagaagcagctttaagggcctat
aaaaagcaaatggcagagttggaagagaagatcttggctggagatagcagttctgtggat
gaaaaggctcgaatagtaagtggcaatgatttggatgcttccaaattttctgcactccag
gtgtgtggtggggctggaggtggactttatggtattgacagcatgccggatcttcgcaga
aaaaaaactttgcctattgtccgagatgtggccatgaccctggctgcccggaaatctgga
ctctccctggctatggtgattaggacatccctaaataatgaggaactgaaaatgcacgtc
ttcaagaagaccttgcaggcactgatctaccctatgtcttctaccatcccacacaatttt
gaggtctggacggctaccacacccacctactgttatgagtgtgaagggctcctgtggggc
attgcaaggcaaggcatgaagtgtctggagtgtggagtgaaatgccacgaaaagtgtcag
gacctgctaaacgctgactgcttgcagagagcagcagaaaagagttctaaacatggtgcc
gaagacaagactcagaccattattacagcaatgaaagaaagaatgaagatcagggagaaa
aaccggccagaagtatttgaagtaatccaggaaatgtttcagatttctaaagaagatttt
gtgcagtttacaaaggcggccaaacagagtgtactggatgggacatctaagtggtctgca
aaaataaccattacagtggtttctgcacagggtctacaggcaaaagataaaacagggtct
agtgatccatatgttacagttcaagttggaaagaacaaaagaagaacaaaaaccattttt
ggaaatttgaatccagtatgggatgagaagttttattttgagtgtcataactccacagat
cgaatcaaagtcagagtatgggatgaagatgatgatattaaatccagagtcaagcaacat
ttcaaaaaggagtcagatgattttctgggacaaacaattgtagaagtgaggaccttgagt
ggagaaatggatgtctggtacaacttagagaaaaggacagataagtcagctgtatctggg
gccatacgattgaaaatcaatgtggagataaaaggagaagagaaggttgctccatatcat
attcaatatacatgtttacatgagaatctgttccattacttgactgaagtgaaatctaat
ggtggagtgaaaatcccagaagtcaaaggggatgaagcctggaaggttttctttgatgat
gcttcccaagaaatagttgatgaatttgctatgcgttatggaattgaatccatttatcaa
gctatgacgcacttttcatgtctgtcttctaaatacatgtgccccggtgtccctgccgtc
atgagcaccttgctggctaatataaatgctttttatgctcacacaacagtttcaacaaac
atacaggtttctgcctcagatcgatttgctgctaccaactttggtagggaaaaattcata
aaactactggaccagttacataactctttgaggattgatctgtcaaagtatagggaaaac
tttcctgcaagcaatactgaaagactgcaagacctgaaatcaactgttgacctgttaaca
agtatcaccttttttaggatgaaggttctggagctgcaaagccccccaaaagcgagcatg
gtggtgaaggactgtgtaagggcttgcctggattctacatacaagtatatttttgacaac
tgccatgaactctactcccagctaacagacccgagtaagaaacaggatattcctcgtgaa
gatcagggaccaaccaccaagaatttggatttttggccccaacttattacactgatggtt
actattattgatgaggataaaactgcctacacacctgtcctgaatcagtttcctcaagag
ctgaacatgggaaaaataagtgccgaaattatgtggactctttttgctctggatatgaaa
tatgcattagaagaacatgaaaatcagcggttatgcaagagcaccgattatatgaatttg
catttcaaagttaaatggttttataatgaatatgtgcgtgaacttcctgccttcaaggat
gctgttcctgaatactccttgtggtttgaaccttttgtcatgcaatggctagatgaaaac
gaagatgtgtcaatggaattccttcatggagcactgggaagagacaaaaaagatggattc
cagcagacatctgagcatgctctcttttcttgctccgtggttgatgtctttgctcagctg
aatcagagctttgaaattattaagaaactggaatgccctaatcctgaagcattatctcac
ttaatgagaagatttgcaaagactatcaataaagtgctgctccagtatgctgcaattgta
tcaagtgatttcagttcacattgtgataaggaaaatgtgccctgtatcttgatgaacaat
attcaacaattgcgggtccagctggaaaaaatgtttgaatccatgggagggaaggagcta
gattctgaagctagtactattctaaaagaacttcaggttaagctcagtggggtcctggat
gagctcagcgtcacttatggtgaaagtttccaggttataattgaagagtgtataaaacag
atgagtttcgaactaaatcaaatgagagcaaatggaaacaccacatctaataagaacagt
gcagcaatggatgcagagattgtgttaagatctcttatggattttttggacaaaacatta
agtctctcagcaaaaatctgtgagaaaacagtcctaaagcgagttttaaaagagttatgg
aagctagttctcaacaaaatagaaaaacaaattgttcttcctcctctgacagatcaaaca
ggaccccagatgattttcattgcagctaaagatcttggacaattatccaaactgaaggag
cacatgattcgagaggatgccaggggtctgacgccaagacaatgcgctataatggaggta
gtcctggctaccatcaagcaatactttcatgcaggaggaaatggcctgaaaaagaatttc
ttggagaaaagcccagatcttcagtctctgagatatgctctcagtctttatacccaaact
actgatgccttgataaagaaattcatagatactcaaacctcacagagtcgttcctccaaa
gatgccgtgggtcagatatctgttcatgtggacatcactgccaccccaggaacgggagat
cataaagtcactgtaaaagtgattgctattaatgacctaaactggcagaccacagcaatg
ttccgcccctttgtggaagtttgtatactgggacccaaccttggagacaagaagagaaaa
caaggcacaaaaacaaaaagcaacacatggtcaccaaagtacaatgaaacatttcagttc
attctcggaaaggaaaatcgaccaggggcttatgaacttcatctctcagttaaggattac
tgctttgccagagaagatcgaattatcggaatgacagtcattcagctacagaacatagca
gaaaagggaagctatggggcatggtatcctcttctgaaaaatatctctatggatgaaact
ggtttgactatccttagaatactctctcagaggaccagtgatgatgtggctaaagaattt
gtaagacttaaatctgaaacaagatctactgaagagagtgcttga

DBGET integrated database retrieval system