KEGG   Homo sapiens (human): 440503
Entry
440503            CDS       T01001                                 

Gene name
PLIN5, LSDA5, LSDP5, MLDP, OXPAT
Definition
(RefSeq) perilipin 5
  KO
K20255  perilipin-5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    440503 (PLIN5)
SSDB
Motif
Pfam: Perilipin Fzo_mitofusin DASH_Dad2
Other DBs
NCBI-GeneID: 440503
NCBI-ProteinID: NP_001013728
OMIM: 613248
HGNC: 33196
Ensembl: ENSG00000214456
Vega: OTTHUMG00000182008
Pharos: Q00G26(Tbio)
UniProt: Q00G26
Position
19p13.3
AA seq 463 aa
MSEEEAAQIPRSSVWEQDQQNVVQRVVALPLVRATCTAVCDVYSAAKDRHPLLGSACRLA
ENCVCGLTTRALDHAQPLLEHLQPQLATMNSLACRGLDKLEEKLPFLQQPSETVVTSAKD
VVASSVTGVVDLARRGRRWSVELKRSVSHAVDVVLEKSEELVDHFLPMTEEELAALAAEA
EGPEVGSVEDQRRQQGYFVRLGSLSARIRHLAYEHSVGKLRQSKHRAQDTLAQLQETLEL
IDHMQCGVTPTAPACPGKVHELWGEWGQRPPESRRRSQAELETLVLSRSLTQELQGTVEA
LESSVRGLPAGAQEKVAEVRRSVDALQTAFADARCFRDVPAAALAEGRGRVAHAHACVDE
LLELVVQAVPLPWLVGPFAPILVERPEPLPDLADLVDEVIGGPDPRWAHLDWPAQQRAWE
AEHRDGSGNGDGDRMGVAGDICEQEPETPSCPVKHTLMPELDF
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtctgaagaagaggcggctcagatccccagatccagtgtgtgggagcaggaccagcag
aacgtggtgcagcgtgtggtggctctgcccctggtcagggccacgtgcaccgcggtctgc
gatgtttacagtgcagccaaggacaggcacccgctgctgggctccgcctgccgcctggct
gagaactgcgtgtgcggcctgaccacccgtgccctggaccacgcccagccgctgctcgag
cacctgcagccccagctggccactatgaacagcctcgcctgcaggggcctggacaagctg
gaagagaagcttccctttctccagcaaccttcggagacggtggtgacctcagccaaggac
gtggtggccagcagtgtcacgggtgtggtggacctggcccggaggggccggcgctggagc
gtggagctgaagcgctccgtgagccatgctgtggatgttgtactggaaaaatcagaggag
ctggtggatcacttcctgcccatgacggaggaagagctcgcggcactggcggctgaggct
gaaggccctgaagtgggttcggtggaggatcagaggagacagcagggctactttgtgcgc
ctcggctccctgtcagcacggatccgccacctggcctacgagcactctgtggggaaactg
aggcagagcaaacaccgtgcccaggacaccctggcccagctgcaggagacgctggagctg
atagaccacatgcagtgtggggtgacccccaccgccccggcctgccctgggaaggtgcac
gagctgtggggggaatggggccagcgccctccggagagccgccgccggagccaggcagag
ctggagacgctggtgctgtcccgcagcctgacccaggagctgcagggcacggtagaggct
ctggagtccagcgtgcggggcctgcccgccggcgcccaggagaaggtggctgaggtgcgg
cgcagtgtggatgccctgcagaccgccttcgctgatgcccgctgcttcagggacgtgcca
gcggccgcgctggccgagggccggggtcgcgtggcccacgcgcacgcctgcgtggacgag
ctgctggagctggtggtgcaggccgtgccgctgccctggctggtgggacccttcgcgccc
atccttgtggagcgacccgagcccctgcccgacctggcggacctggtggacgaggtcatc
gggggccctgacccccgctgggcgcacctggactggccggcccagcagagagcctgggag
gcagagcacagggacgggagtgggaatggggatggggacaggatgggtgttgccggggac
atctgcgagcaggaacccgagacccccagctgcccggtcaagcacaccctgatgcccgag
ctggacttctga

DBGET integrated database retrieval system