KEGG   Homo sapiens (human): 440563Help
Entry
440563            CDS       T01001                                 

Gene name
HNRNPCL2, HNRNPCP5
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein C like 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 XhlA Nup88 DUF16
Motif
Other DBs
NCBI-GeneID: 440563
NCBI-ProteinID: NP_001130033
HGNC: 48813
Ensembl: ENSG00000275774
Vega: OTTHUMG00000009503
Pharos: B2RXH8(Tdark)
UniProt: B2RXH8
Position
1p36.21
AA seq 293 aa AA seqDB search
MASNVTNKMDPHSVNSRVFIGNLNTLVVKKSDVEAIFSKYGKIAGCSVHKGFAFVQYDKE
KNARAAVAGEDGRMIASQVAVINLAAEPKVNRGNAGVKRSAAEMYGSSFDLDYGFQRDYY
DGMYSFPARVPPPPPIALAVVPSKRQRISGNTSRRGKSGFNSKSGKRGSSKSGKLKGDDL
QAIKQELTQIKQKVDSLLENLEKIEKEQSKQEVEVKNAKSEEEQSSSSMKKDETHVKMES
EGGAEDSAEEGDPLDDDDNEDQGDNQLHLIKNNEKDAEEGEDNRDSTNGQDDS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaacgttaccaacaagatggatcctcactccgtgaactcccgtgtgttcatt
gggaatctcaacactcttgttgtcaagaaatctgatgtggaggcgatcttttccaagtat
ggcaaaattgcgggctgctctgttcataagggctttgccttcgttcaatatgataaggag
aaaaatgcccgggctgctgtagcaggagaggatggcagaatgattgctagccaggttgca
gttattaacctggctgcagagccaaaagtgaaccgaggaaacgcaggtgtgaaacgatcc
gcagcggagatgtacggctcctcttttgacttggactatggctttcaacgggattattat
gatgggatgtacagtttcccagcacgtgtacctcctcctcctcccattgctctggctgta
gtgccctcgaaacgccagcgcatatcaggaaacacctcacgaaggggcaaaagtggcttc
aattctaagagtggaaagcggggatcttccaagtctggaaagctgaaaggagatgacctt
caggccattaagcaggagttgacccagataaaacagaaagtggattctctcctggaaaac
ctggaaaaaattgaaaaggaacagagcaaacaagaggtagaggtgaaaaatgctaagtca
gaagaggagcagagcagtagctccatgaagaaagatgagactcatgtaaagatggagtct
gaggggggtgcagaagactctgctgaggagggggacccactggatgatgatgataatgaa
gatcagggggacaaccagcttcatttgatcaagaataatgaaaaagatgctgaggaagga
gaggataacagagacagcaccaatggccaggatgactcttaa

DBGET integrated database retrieval system