KEGG   Homo sapiens (human): 440567Help
Entry
440567            CDS       T01001                                 

Gene name
UQCRHL
Definition
(RefSeq) ubiquinol-cytochrome c reductase hinge protein like
  KO
K00416  ubiquinol-cytochrome c reductase subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    440567 (UQCRHL)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    440567 (UQCRHL)
  09159 Environmental adaptation
   04714 Thermogenesis
    440567 (UQCRHL)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    440567 (UQCRHL)
   05012 Parkinson disease
    440567 (UQCRHL)
   05016 Huntington disease
    440567 (UQCRHL)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    440567 (UQCRHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCR_hinge Syntaxin-6_N
Motif
Other DBs
NCBI-GeneID: 440567
NCBI-ProteinID: NP_001083060
HGNC: 51714
Ensembl: ENSG00000233954
Vega: OTTHUMG00000003109
UniProt: A0A096LP55
Position
1p36.21
AA seq 91 aa AA seqDB search
MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSR
SHTEEDCTEELFDFLHAKDHCVAHKLFNNLK
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgggactggaggacgagcaaaagatgcttaccgaatccggagatcctgaggaggaggaa
gaggaagaggaggaattagtggatcccctaacaacagtgagagagcaatgcgagcagttg
gagaaatgtgtaaaggcccgggagcggctagagctctatgatgagcatgtatcctctcga
tcacatacagaagaggattgcacggaggagctctttgacttcttgcatgcaaaggaccat
tgcgtggcccacaaactctttaacaacttgaaataa

DBGET integrated database retrieval system