KEGG   Homo sapiens (human): 440822
Entry
440822            CDS       T01001                                 

Gene name
PIWIL3, HIWI3
Definition
(RefSeq) piwi like RNA-mediated gene silencing 3
  KO
K02156  aubergine
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    440822 (PIWIL3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    440822 (PIWIL3)
   piRNA pathway
    440822 (PIWIL3)
SSDB
Motif
Pfam: Piwi PAZ ArgoN ArgoL1 ArgoL2 DDE_Tnp_1_6
Other DBs
NCBI-GeneID: 440822
NCBI-ProteinID: NP_001008496
OMIM: 610314
HGNC: 18443
Ensembl: ENSG00000184571
Vega: OTTHUMG00000150788
Pharos: Q7Z3Z3(Tdark)
UniProt: Q7Z3Z3
Position
22q11.23
AA seq 882 aa
MPGRARTRARGRARRRESYQQEAPGGPRAPGSATTQEPPQLQSTPRPLQEEVPVVRPLQP
RAARGGAGGGAQSQGVKEPGPEAGLHTAPLQERRIGGVFQDLVVNTRQDMKHVKDSKTGS
EGTVVQLLANHFRVISRPQWVAYKYNVDYKPDIEDGNLRTILLDQHRRKFGERHIFDGNS
LLLSRPLKERRVEWLSTTKDKNIVKITVEFSKELTPTSPDCLRYYNILFRRTFKLLDFEQ
VGRNYYTKKKAIQLYRHGTSLEIWLGYVTSVLQYENSITLCADVSHKLLRIETAYDFIKR
TSAQAQTGNIREEVTNKLIGSIVLTKYNNKTYRVDDIDWKQNPEDTFNKSDGSKITYIDY
YRQQHKEIVTVKKQPLLVSQGRWKKGLTGTQREPILLIPQLCHMTGLTDEICKDYSIVKE
LAKHTRLSPRRRHHTLKEFINTLQDNKKVRELLQLWDLKFDTNFLSVPGRVLKNANIVQG
RRMVKANSQGDWSREIRELPLLNAMPLHSWLILYSRSSHREAMSLKGHLQSVTAPMGITM
KPAEMIEVDGDANSYIDTLRKYTRPTLQMGMSCLLVFKVICILPNDDKRRYDSIKRYLCT
KCPIPSQCVVKKTLEKVQARTIVTKIAQQMNCKMGGALWKVETDVQRTMFVGIDCFHDIV
NRQKSIAGFVASTNAELTKWYSQCVIQKTGEELVKELEICLKAALDVWCKNESSMPHSVI
VYRDGVGDGQLQALLDHEAKKMSTYLKTISPNNFTLAFIVVKKRINTRFFLKHGSNFQNP
PPGTVIDVELTRNEWYDFFIVSQSVQDGTVTPTHYNVIYDTIGLSPDTVQRLTYCLCHMY
YNLPGIIRVPAPCHYAHKLAYLVGQSIHQEPNRSLSTRLFYL
NT seq 2649 nt   +upstreamnt  +downstreamnt
atgcctggtagggcaaggactcgcgcccgaggcagagcccgccgcagggagagctaccaa
caagaggcacctgggggacccagagcacctggatcagctacaacccaggagccccctcag
ttgcagtcgacaccccggccgctgcaggaggaagtcccagtggttagacctctgcagcca
agagcagcaagaggaggagcaggaggaggagcacagtctcaaggggtgaaggaacctgga
cctgaggctgggttgcatacagcgcccttgcaggagagaaggattggtggagtttttcaa
gacctggtggtgaacaccaggcaagatatgaagcatgttaaagactcaaaaacaggttca
gagggtacagtggtacagctactcgccaaccacttccgagtgatatctcgtcctcagtgg
gttgcatataaatacaacgttgactacaaaccagacatagaagatggaaatctccgtaca
attttacttgatcaacatagaaggaaatttggagagcgccatatatttgatggaaactct
ttattattatctcggccactaaaagagcggagagtggaatggttgagcacaaccaaagac
aaaaacatcgtgaagattacagttgagttttccaaagaactcacgcccacgtcgccagat
tgcctacgctattacaacattctctttagaagaactttcaagctgctggattttgaacaa
gttggtcgcaactattataccaaaaagaaggccattcagttataccgtcatggtaccagt
ttggaaatctggcttggttatgttacttctgttcttcaatacgaaaacagcattaccctc
tgtgccgatgtgagccacaaactgctccgaatagaaactgcttatgatttcataaagaga
acatctgcccaggcccagacaggaaacatccgagaggaagtaactaataaattaattgga
tcaattgttctgacaaaatacaacaacaaaacctacagagtagatgatattgattggaag
cagaatcctgaagacacatttaacaaatcagatggcagcaaaatcacctatatagactac
tacaggcagcaacataaagaaattgtcacagtgaagaaacagccacttttggtcagccag
ggcagatggaaaaagggcctaacgggtacacaacgtgaacctatcctgctgattcctcag
ctgtgccacatgacaggtctaacagatgaaatatgtaaagattatagcattgtgaaagaa
ttggctaaacatacaagattgagtccaagaagaaggcatcatacattaaaagaattcatc
aatactctacaagataataaaaaagtacgagagttacttcaactctgggatttgaaattt
gataccaattttttgtccgtcccgggaagagttttgaaaaacgcaaacatcgtgcaaggc
agaagaatggttaaagccaattcacaaggagactggtcaagagaaataagagaattaccc
ttacttaatgcaatgccactacatagttggctcatactctatagcaggagcagtcacaga
gaagccatgtccttaaagggtcatctacagagtgtcacagcccccatgggcataactatg
aaaccagcagaaatgattgaagtagatggtgatgctaactcctatatagacacattacgg
aaatatactagaccaacactgcagatgggaatgtcatgtttgctggttttcaaggtgatt
tgtatcctgcccaatgatgacaaacgtagatatgacagcataaaaagatacctatgtacc
aaatgcccaattccaagccagtgtgtggtgaaaaagaccttagaaaaagtccaggcaagg
accatcgtcaccaagattgcccagcagatgaattgcaagatgggaggagccctctggaag
gtggagacagacgtacaaagaacaatgttcgttggcattgattgtttccacgatatcgta
aatcgacagaaatcaatagcaggatttgttgcaagtaccaatgctgaattaacaaagtgg
tactctcaatgtgtcatccagaaaacaggagaagagcttgtgaaagagctggagatctgc
ttgaaagctgccctggatgtctggtgtaaaaacgaatcatcgatgccacattctgttatt
gtgtatcgggatggagtgggagatggtcagcttcaagcattgcttgaccatgaagcgaaa
aagatgtcgacctacttaaaaaccatctctcctaacaatttcactctagctttcattgtg
gtgaagaaacgaataaacactagattttttcttaaacatggaagcaattttcaaaatcca
cctccaggaacagttattgatgtagagttgactaggaatgaatggtatgacttttttatt
gtgagtcagtctgtgcaagatgggactgttacccccactcattataacgtcatctatgac
acgattggcttgagcccagatacagtacagcgtttaacatattgtctatgccacatgtat
tataatttgccaggcatcatccgagttccagcgccttgccactatgcccacaagctggct
tacctcgtggggcagtccattcaccaggaaccgaatcgttccttgtcaactcgtctcttt
tacctttga

DBGET integrated database retrieval system