KEGG   Homo sapiens (human): 441150
Entry
441150            CDS       T01001                                 
Symbol
C6orf226
Name
(RefSeq) chromosome 6 open reading frame 226
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF5572
Other DBs
NCBI-GeneID: 441150
NCBI-ProteinID: NP_001008739
HGNC: 34431
Ensembl: ENSG00000221821
Pharos: Q5I0X4(Tdark)
UniProt: Q5I0X4
Position
6:complement(42890265..42890821)
AA seq 101 aa
MERPRSPQCSAPASASASVTLAQLLQLVQQGQELPGLEKRHIAAIHGEPTASRLPRRPKP
WEAAALAESLPPPTLRIGTAPAEPGLVEAATAPSSWHTVGP
NT seq 306 nt   +upstreamnt  +downstreamnt
atggagcgtccccgcagtccccaatgctcggccccggcctctgcctcagcttcggttacc
ctggcgcagctcctgcagctggtccagcagggccaggaactcccgggcctggagaaacgc
cacatcgcggcgatccacggcgaacccacagcgtcccggctgccgcggaggcccaagccc
tgggaggccgcggctttggctgagtcccttccccctccgaccctcaggataggaacggcc
ccggcggagcctggcttggttgaggcagcgactgcgccttcttcatggcatacagtgggc
ccctga

DBGET integrated database retrieval system