KEGG   Homo sapiens (human): 441381Help
Entry
441381            CDS       T01001                                 

Gene name
LRRC24, LRRC14OS
Definition
(RefSeq) leucine rich repeat containing 24
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 Ig_3 LRR_4 I-set LRR_9 Ig_2 ig V-set LRRCT Herpes_gE PRIMA1 TPKR_C2 LRRNT EphA2_TM
Motif
Other DBs
NCBI-GeneID: 441381
NCBI-ProteinID: NP_001019849
HGNC: 28947
Ensembl: ENSG00000254402
Vega: OTTHUMG00000165180
Pharos: Q50LG9(Tdark)
UniProt: Q50LG9
Position
8q24.3
AA seq 513 aa AA seqDB search
MALRAPALLPLLLLLLPLRAAGCPAACRCYSATVECGALRLRVVPLGIPPGTQTLFLQDN
NIARLEPGALAPLAALRRLYLHNNSLRALEAGAFRAQPRLLELALTSNRLRGLRSGAFVG
LAQLRVLYLAGNQLARLLDFTFLHLPRLQELHLQENSIELLEDQALAGLSSLALLDLSRN
QLGTISREALQPLASLQVLRLTENPWRCDCALHWLGAWIKEGGQRLLTSRDRKIMCAEPP
RLALQSLLDVSHSSLICIPPSVHVQPLELTANLGEDLRVACQASGYPQPLVTWRKVPQPR
EGRPRAQAQLEGGLLGLGGHSASDTGSGMLFLSNITLAHAGKYECEASNAGGAARVPFRL
LVNASRQQPQQPAQPPPPAARPAGSEPRPEAGSMAFRALGVATQTAIAAAIALLALTALL
LVAMICRRRRRRKKARGPPGEGALFVNDYLDGPCTFAQLEELRDERGHEMFVINRSKPLF
AEGPAEAPADCGPEQGAGPGLRVPPPVAYEIHC
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggccctgagggcccccgcactgctgccgctgctgctgctactactgccgctccgcgcc
gccggctgcccagcagcctgccgctgctacagcgccacggtggagtgtggcgccctgcgg
ttgcgcgtcgtcccgctgggaatcccgccagggacgcagacactgttcctgcaggacaac
aacatcgcccgcctagagccgggagccctggcgccactcgccgctctgcgccggctctac
ctgcacaacaacagcctgcgcgccctggaggccggcgccttccgcgcgcagccgcgcctg
ctggagctggcgctcactagcaaccggctgcgcggcttgcgcagcggcgccttcgtaggc
ctggcccagctgcgcgtgctctacctggcgggcaaccagctggcgcggctgctggatttc
accttcttgcacctgccgcgactgcaggagcttcacctgcaagaaaacagcattgagctg
ctggaggaccaggctctagcggggctgtcctccctagcactgctggacctcagcaggaac
cagctgggcaccatcagccgagaggccctgcagcccctggccagtctgcaagtcctgcgc
ctcacagagaacccatggcgctgtgactgcgccctgcactggctgggtgcctggatcaag
gagggcggccagcggctgctcacctccagggacaggaagatcatgtgtgcagagcccccg
cgcctggcgctccagagtctcctggacgtatcccacagcagcctcatctgcattccgccc
tctgtccacgtgcagccgctggagctcacagccaacctgggtgaggacctgcgggttgcc
tgccaagcctccggctacccgcagccattggtgacctggagaaaggtgccccagcctcgc
gagggccggccgcgagcccaggcccagctagaaggcgggttgctgggcctgggcggacac
tcggcatccgacacgggcagcggcatgctcttcctcagcaacatcacgctggcgcacgcc
ggtaagtacgagtgcgaggcctccaacgccggcggcgctgcccgcgtgcccttccggctc
ctggtcaacgcgtcccggcagcagccgcagcagcccgcgcaaccgccgcctccggccgcc
cgccccgccggcagcgagccccggcccgaggcgggcagcatggccttccgcgccctgggc
gtggccacacagacggccattgcggcggccatcgcgctgctggcgctcacggcgctgctc
ctggtcgccatgatctgtcgccggcgccgcaggcgaaaaaaggcgcgggggcctccgggg
gagggagcgctgttcgtcaacgactacttggacggcccctgtacgttcgcacagctagag
gagctccgcgacgagcgcggccacgagatgttcgtcatcaaccgctccaagccgctcttc
gccgagggtccggcggaggcgcccgctgactgcggcccggaacagggggcggggccggga
ctccgcgtgcccccgccggtcgcctacgagatccactgctag

DBGET integrated database retrieval system