KEGG   Homo sapiens (human): 441521Help
Entry
441521            CDS       T01001                                 

Gene name
CT45A5, CT45-3, CT45-4, CT45-6, CT45.5, CT455, CT45A3, CT45A4, CT45A6, CT45A7
Definition
(RefSeq) cancer/testis antigen family 45 member A5
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: INT_SG_DDX_CT_C
Motif
Other DBs
NCBI-GeneID: 441521
NCBI-ProteinID: NP_001007552
OMIM: 300796
HGNC: 33270
Ensembl: ENSG00000228836
Vega: OTTHUMG00000188603
UniProt: P0DMU8 P0DMU7 P0DMV0
Position
Xq26.3
AA seq 189 aa AA seqDB search
MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMT
GHAIPPSQLDSQIDDFTGFSKDGMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQR
EINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKH
LKKKLKRMI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataaaacagagaaggtggctgtagatcctgaaactgtgtttaaacgtcccagg
gaatgtgacagtccttcgtatcagaaaaggcagaggatggccctgttggcaaggaaacaa
ggagcaggagacagccttattgcaggctctgccatgtccaaagaaaagaagcttatgaca
ggacatgctattccacccagccaattggattctcagattgatgacttcactggtttcagc
aaagatgggatgatgcagaaacctggtagcaatgcacctgtgggaggaaacgttaccagc
agtttctctggagatgacctagaatgcagagaaacagcctcctctcccaaaagccaacga
gaaattaatgctgatataaaacgtaaattagtgaaggaactccgatgcgttggacaaaaa
tatgaaaaaatcttcgaaatgcttgaaggagtgcaaggacctactgcagtcaggaagcga
ttttttgaatccatcatcaaggaagcagcaagatgtatgagacgagactttgttaagcac
cttaagaagaaactgaaacgtatgatttga

DBGET integrated database retrieval system