KEGG   Homo sapiens (human): 441873Help
Entry
441873            CDS       T01001                                 

Gene name
PRAMEF25
Definition
(RefSeq) PRAME family member 25
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Zn_Tnp_IS1595
Motif
Other DBs
NCBI-GeneID: 441873
NCBI-ProteinID: NP_001297063
HGNC: 49179
Ensembl: ENSG00000229571
UniProt: A6NGN4
Position
1p36.21
AA seq 478 aa AA seqDB search
MKMSIRTPPRLLELAGRSVLRDQALAMSTLEELPTELFPPLFMEAFSRRRCEALKLMVQA
WPFRRLPLRPLIKMPCLETFQAVLNGLDALLTHGVRPRRWKLQVLDLQDVCENFWMVWSE
AMARGCFLNAKRNKKPVQDCPRMRGRQPLTVFVELWLKNRTLDEHLTCLLLWVKQRKDLL
HLCCKKLKILGMPFRNIRSILKMVNLDCIQEVEVNCKWVLPILTQFTPYLGHMRNLQKLV
LSHMDVSRYVSPEQKKEIVTQFTTQFLKLHCLQKLYMNSVSFLEGHLDQLLSCLKTSLKV
LTITNCVLLESDLKHLSQCPSISQLKTLDLSGIRLTNYSLVPLQILLEKVAATLEYLDLD
DCGIIDSQVNAILPALSRCFELNTFSFCGNPISMATLENLLSHTIILKNLCLELYPAPRE
SYGADGTLCWSRFTQIRAELMKRVRDLRHPKRILFGTDYCPDCGNRSFYDLEADQYCC
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgagcatccggactccacccagactcctggagctggcggggcggagcgtgctg
agggaccaagccttggccatgtccaccctggaggagctgcccacagaacttttcccccca
ctgttcatggaggccttcagcaggagacgctgtgaggccctgaagctgatggtacaggcc
tggcccttccgccgcctccctctgaggcctctgataaagatgccttgtctggagaccttc
caagctgtgctcaatgggcttgatgcactgcttacccacggggttcgtcccaggaggtgg
aaacttcaagtgctggatttacaggatgtctgtgagaacttctggatggtttggtctgaa
gctatggcccgtgggtgcttcctcaatgccaagaggaacaaaaaaccagtgcaggactgt
ccaaggatgagaggacggcagcccttgactgtgttcgtagaactttggctcaagaacagg
actctggatgaacacctcacctgcctccttctatgggtcaagcagaggaaagatttacta
cacctgtgctgtaagaagctgaaaattttgggaatgcccttccgcaatatcagaagcatc
ctgaaaatggtgaacctagactgtatccaggaggtggaagtgaattgcaagtgggtactg
cccatcctgacacagtttaccccatacctgggccacatgaggaatcttcagaagctcgtt
ctctcccacatggatgtctctcgctacgtttccccagagcagaagaaggagattgttacc
cagttcaccactcagttcctcaagctgcactgcctccaaaagctttatatgaactctgtt
tctttcctcgaaggccacctggaccagctgctcagctgtctgaagacctcgttaaaggtc
ctcacaataactaactgtgtgcttttggaatcagacttgaagcatctatcccagtgcccg
agtatcagtcaactaaagaccctggacctgagtggcatcagactgaccaattacagtctt
gtgcctctccaaattctcctagaaaaagttgcagccacccttgagtacctggatttagat
gactgtggcatcatagactcccaagtcaacgccatcctgcctgccctgagccgctgcttt
gagctcaacaccttcagcttctgtggaaatcccatctccatggccaccctggagaacctg
ctgagccacacaatcatactcaaaaacttatgcctggagctgtatcctgccccacgggag
agttatggtgctgatggtactctctgctggagcagatttactcagattagggctgagctg
atgaagagagttagggacttaaggcaccccaagaggatcttgttcggtactgactactgc
cctgactgtggcaacaggtcattttatgacctggaggcagatcaatactgctgttga

DBGET integrated database retrieval system