KEGG   Homo sapiens (human): 442185Help
Entry
442185            CDS       T01001                                 

Gene name
OR2J1, 6M1-4P, OR2J1P, OR6-15, OR6-5, dJ80I19.2, hs6M1-4
Definition
(RefSeq) olfactory receptor family 2 subfamily J member 1 (gene/pseudogene)
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    442185 (OR2J1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    442185 (OR2J1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    442185 (OR2J1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 442185
NCBI-ProteinID: NP_001335223
HGNC: 8259
Ensembl: ENSG00000204702
Vega: OTTHUMG00000031280
UniProt: Q9GZK6
Position
6p22.1
AA seq 312 aa AA seqDB search
MLMKKNASFEDFFLLLGFSNWPHLEVVLFVVILIFYLITLIGNLFIIILSYLDSHLHTPM
YFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCTVQLYFVLALGTAECVLLVVMS
YDRYAAVCRPLHYTVLMHPRFCRLLAAASWVSGFTTSALHSSFTFWIPLCRHRLVDHFFC
EVPALLRLSCVDTQANELTLMVMSSIFVLIPLILILTSYGAIARAVLSMQSTTGLQKVLR
TCGAHLMVVSLFFIPVMCMYLQPPSENSQDQGKFIALFYTVVTPSLNPLIYTFRNKDVRG
AVKRLMGWEWGM
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgttgatgaaaaaaaatgcaagttttgaagacttctttcttctacttggattttctaac
tggcctcatctggaagtagttctctttgtggttatcttgatcttctacttgataacactg
ataggaaacctgttcatcatcatcctgtcatacctggactcccatctccacactcccatg
tacttcttcctttcaaatctctcatttctggatctctgctacaccaccagctctatccct
cagttgctggtgaatctctggggcccggaaaagaccatctcttatgctggttgtacggtt
caactttactttgttctcgcactgggaaccgcagagtgtgtcctactggtggtgatgtcc
tatgatcgttatgcagctgtgtgtagacctttgcattacactgtcctcatgcaccctcgt
ttctgccgcttgttggctgcggcttcttgggtaagtggttttacaacctcagcacttcat
tcctcctttactttctggatacccctatgtagacatcgcctagtggatcacttcttctgt
gaagttccagcacttctgcgattatcatgtgttgatacccaggcaaatgagctgaccctc
atggtcatgagctccatatttgttctcatacctctcatcctcatcctcacttcctatggt
gccattgcccgggctgtactgagcatgcaatcaaccactgggcttcagaaagtgcttagg
acatgtggagcccatcttatggttgtatctctctttttcattccagtcatgtgcatgtat
ctccagccaccatcagaaaattctcaagatcaaggcaagttcattgccctcttttacact
gttgtcacacctagtcttaaccctctaatctacactttcagaaacaaggatgtaagaggg
gcagtgaagagactaatggggtgggaatgggggatgtga

DBGET integrated database retrieval system