KEGG   Homo sapiens (human): 442361Help
Entry
442361            CDS       T01001                                 

Gene name
OR2A2, OR2A17P, OR2A2P, OR7-11, OST008
Definition
(RefSeq) olfactory receptor family 2 subfamily A member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    442361 (OR2A2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    442361 (OR2A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 442361
NCBI-ProteinID: NP_001005480
HGNC: 8230
Ensembl: ENSG00000221989
Vega: OTTHUMG00000158001
Pharos: Q6IF42(Tdark)
UniProt: Q6IF42 A0A126GW45
Position
7q35
AA seq 318 aa AA seqDB search
MEGNQTWITDITLLGFQVGPALAILLCGLFSVFYTLTLLGNGVIFGIICLDSKLHTPMYF
FLSHLAIIDMSYASNNVPKMLANLMNQKRTISFVPCIMQTFLYLAFAVTECLILVVMSYD
RYVAICHPFQYTVIMSWRVCTILVLTSWSCGFALSLVHEILLLRLPFCGPRDVNHLFCEI
LSVLKLACADTWVNQVVIFATCVFVLVGPLSLILVSYMHILGAILKIQTKEGRIKAFSTC
SSHLCVVGLFFGIAMVVYMVPDSNQREEQEKMLSLFHSVFNPMLNPLIYSLRNAQLKGAL
HRALQRKRSMRTVYGLCL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcaaccagacatggatcacagacatcaccctgctgggattccaggttggtcca
gcactggcgattctcctctgtggactcttctctgtcttctatacactcaccctgctgggg
aatggggtcatctttgggattatctgcctggactctaagcttcacacacccatgtacttc
ttcctctcacacctggccatcattgacatgtcctatgcttccaacaatgttcccaagatg
ttggcaaacctaatgaaccagaaaagaaccatctcctttgttccatgcataatgcagact
tttttgtatttggcttttgctgttacagagtgcctgattttggtggtgatgtcctatgat
aggtatgtggccatctgccaccctttccagtacactgtcatcatgagctggagagtgtgc
acgatcctggttctcacgtcctggtcatgtgggtttgccctgtccctggtacatgaaatt
ctccttctaaggttgcccttctgtgggccccgggatgtgaaccacctcttctgtgaaatt
ctgtctgtcctcaagctggcctgtgctgacacctgggttaaccaagtggtcatatttgct
acctgtgtgtttgtcttagtcgggcctctttccttgattctggtctcctacatgcacatc
ctcggggccatcctgaagatccagacaaaggagggccgcataaaggccttctccacctgc
tcctcccacctgtgtgtggttggactattctttggcatagccatggtggtttacatggtc
ccagactctaatcaacgagaggagcaggagaaaatgctgtccctgtttcacagtgtcttt
aatccaatgctgaaccccctgatctacagcctgaggaatgctcagttgaagggcgccctc
cacagagcactccagaggaagaggtccatgagaacggtgtatgggctttgcctttaa

DBGET integrated database retrieval system